Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010067 (Rassf1)
Chromosomal location
Chr 9: 107453898 - 107464594 (+)
Description
Ras association (RalGDS/AF-6) domain family member 1 Gene [Source:MGI (curated);Acc:Rassf1-002]
RefSeq_dna
NM_019713 
RefSeq_peptide
NP_062687.1 
UniGene
Mm.12091 
MGI
MGI:1928386 
Uniprot/SWISSPROT
Q99MK9 
Uniprot/SPTREMBL
Q3UIV8 B0QZV8 B0QZV7 A9YZW8 
Human Ortholog
ENSG00000068028 (RASSF1)
Omim not available
UniTrap UNI31817
Vector Insertion
Chr 9: 107454178 - 107456456
Public Clones IST12126G12 (tigm) IST14390H10 (tigm) IST13142H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2968
Vector Insertion
Chr 9: 107457257 - 107458941
Public Clones AB0333 (sanger) IST14980A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19406
Vector Insertion
Chr 9: 107459083 - 107459783
Public Clones not available
Private Clones OST391725 (lexicon) OST68141 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18078
Vector Insertion
Chr 9: 107459889 - 107460100
Public Clones not available
Private Clones OST430802 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121635
Sequence
AGACAGCGAGGGGGAAGAACAGCAGCCTCCCTGCTTGCTGCTGGTAGGACAGGCTCTGCTGGGAAATTGCCTGTACACCTCTGGCAGATGAGAACCTGGA

TTGAAGCTGCCTTCTATGTAGCTTGAGTCGGGGGGTAAATG - UNI19406 - GATGAGGCTGTAGAGCGGGAGACACCCGATCTTTCTCAAGCTGAG

ACTGAGCAGAAAATCAAGGACTACAATGGCCAGATCAACAGCAACCTCTTCATGAGCCTG - UNI18078 - AATAAGGATGGCTCCTACACAGGCTT

CATCAAGGTTCAGCTGAAACTAGTGCGTCCTGTTTCAGTGCCTTCCAGCAAGAAACCACCTTCCTTACAGGACGCCCGGAGAGGTACGGGGCGGAGCACA

GCCGTGAAGCGCCGCACCTCTTTTTACTTGCCTAAGGATGCTATTAAGCATCTGCATGTTCTATCACGAACACGGGCACGTGAGGTCATTGAGGCCCTGC

TTCGAAAATTCATGGTCGTAGATGATCCTCGCAAGTTTGCACTCTTTGAGCGAACTGAACGGCATGGCCAAG TATACCTCCGGAAGCTGTCGGATGACG

AGCAGCCCTTGAAGCTGCGGCTTCTTGCAGGGCCCAGTGAAAAAGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCGGGAGAGGTGAAC TGGGATGCCT

TCAGCATGCCTGAACTGCACAATTTCCTACGAATCCTGCAGCGGGAAGAAGAGGAACACCTTCGCCAGATCCTGCAGAAGTATTCTCGTTGTCGCCAGAA

GATCCAGGAGGCTCTGCACGCCTGTCCTTTGGGGTGACCTTGGGTCTCCATGGATGACAGGAGGAGAACAGGCAGTGCAAAGAGCGTGCCGTGTGAGTGT

GACAGGGCCTGTGGGGCCTGAGGAGTGCGTGTGCATGGAGGTCCTCCTCTGCTGACCGGGATGAGCCCAGAGAACAGGGAAAGAGCCAGCCGTCTACCTG

TGGATATAGTGGGGCGGGGCTTTGCATCCCTCTGCCCGTATGTACTGGGTCATACTCTGCGTAGCTGCTCAAGTCACAGGGTCGCAGCTGTGAGAATCTT

AGAGACTCTACAGACAAAACAAGGTTATATTTTCACGGGTAAGAGACCTTACCTATGGAGAAAGATTGTTTTGAGTCATGAATGGGTCTCAGGATAGCCC

TATCAGAGCCAAGGGTAGCTGCTCAGAATAATACAAGCAATTAAGGTAGAGTCTGGGGTTCCCTCTTACCGTGCCTTCTGACTTCCAAACAAACACCCTG

GGGTCAGAGAGGGCTGGCCAGTACAACAACTACAGTGGCTCAGTCAGTGCCTCCTCTAAGGGAAAGGTTGCTGGACCAGACCCTCTTCTTGTTTGCCAAA

GCCAGAGTCTCCCTCAGATATTTTTGATGGAAGTGTATGAATGTATGTAATGTTTTGTGGCCTCAACTGAATGTGGGGAAGGGATGGGGGTGTGACAGTC

ATCATCAGGGCCTGATGCCTGAGAGAATTGGCTGAATAAAGATGTAAGAATTTTT
Translation
M - UNI19406 - DEAVERETPDLSQAETEQKIKDYNGQINSNLFMSL - UNI18078 - NKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARR

GTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALFERTERHGQV VYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDS

GEVN WDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
Transcript ENSMUST00000010211
Sequence
GGGATCGGGCGGGTAAGGCGATGGGCGAGGCTGAAACACCTTCCTTCGAAATGACCTGGAGCAGCACAACCAGCAGTGGCTACTGCAGCCAGGAGGACTC

GGACTCGGAGCTCGAGCAGTACTTCACGGCGCGTACCTCGCTGGTCCGCAGGCCGCGTCGGGACCAG - UNI2968 - - UNI19406 - GATGAGG

CTGTAGAGCGGGAGACACCCGATCTTTCTCAAGCTGAGACTGAGCAGAAAATCAAGGACTACAATGGCCAGATCAACAGCAACCTCTTCATGAGCCTG -

 UNI18078 - AATAAGGATGGCTCCTACACAGGCTTCATCAAGGTTCAGCTGAAACTAGTGCGTCCTGTTTCAGTGCCTTCCAGCAAGAAACCACCTT

CCTTACAGGACGCCCGGAGAGGTACGGGGCGGAGCACAGCCGTGAAGCGCCGCACCTCTTTTTACTTGCCTAAGGATGCTATTAAGCATCTGCATGTTCT

ATCACGAACACGGGCACGTGAGGTCATTGAGGCCCTGCTTCGAAAATTCATGGTCGTAGATGATCCTCGCAAGTTTGCACTCTTTGAGCGAACTGAACGG

CATGGCCAAG TATACCTCCGGAAGCTGTCGGATGACGAGCAGCCCTTGAAGCTGCGGCTTCTTGCAGGGCCCAGTGAAAAAGCCCTGAGCTTTGTCCTG

AAGGAAAATGACTCGGGAGAGGTGAAC TGGGATGCCTTCAGCATGCCTGAACTGCACAATTTCCTACGAATCCTGCAGCGGGAAGAAGAGGAACACCTT

CGCCAGATCCTGCAGAAGTATTCTCGTTGTCGCCAGAAGATCCAGGAGGCTCTGCACGCCTGTCCTTTGGGGTGACCTTGGGTCTCCATGGATGACAGGA

GGAGAACAGGCAGTGCAAAGAGCGTGCCGTGTGAGTGTGACAGGGCCTGTGGGGCCTGAGGAGTGCGTGTGCATGGAGGTCCTCCTCTGCTGACCGGGAT

GAGCCCAGAGAACAGGGAAAGAGCCAGCCGTCTACCTGTGGATATAGTGGGGCGGGGCTTTGCATCCCTCTGCCCGTATGTACTGGGTCATACTCTGCGT

AGCTGCTCAAGTCACAGGGTCGCAGCTGTGAGAATCTTAGAGACTCTACAGACAAAACAAGGTTATATTTTCACGGGTAAGAGACCTTACCTATGGAGAA

AGATTGTTTTGAGTCATGAATGGGTCTCAGGATAGCCCTATCAGAGCCAAGGGTAGCTGCTCAGAATAATACAAGCAATTAAGGTAGAGTCTGGGGTTCC

CTCTTACCGTGCCTTCTGACTTCCAAACAAACACCCTGGGGTCAGAGAGGGCTGGCCAGTACAACAACTACAGTGGCTCAGTCAGTGCCTCCTCTAAGGG

AAAGGTTGCTGGACCAGACCCTCTTCTTGTTTGCCAAAGCCAGAGTCTCCCTCAGATATTTTTGATGGAAGTGTATGAATGTATGTAATGTTTTGTGGCC

TCAACTGAATGTGGGGAAGGGATGGGGGTGTGACAGTCATCATCAGGGCCTGATGCCTGAGAGAATTGGCTGAATAAAGATGTAAGAATT
Translation
MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQ - UNI2968 - - UNI19406 - DEAVERETPDLSQAETEQKIKDYNG

QINSNLFMSL - UNI18078 - NKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALL

RKFMVVDDPRKFALFERTERHGQV VYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVN WDAFSMPELHNFLRILQREEEEHLRQILQKYSRCR

QKIQEALHACPLG
Transcript ENSMUST00000122225
Sequence
AGTCCGCTACAGCACCGGCCTGACCGGGCCATGTCGGCGGAGCCAGAACTCATTGAACTACGCGAGCTGGCACCGTCCGGGCGCATCGGTCCAGGCCGTA

CCCGGCTGGAGCGTGCCAACGCTCTGCGCATCGCCCCGGGTACAACACGCAATCCGTCACAGCAGCACGTCCCGGGTCGTGGCCACCGTTTCCAGCCTGC

AGGGCCCACCACGCACACGTGGTGCGACCTCTGTGGAGACTTCATCTGGGGCGTCGTGCGCAAGGGCCTACAGTGCGCGC - UNI31817 - CCCTTT

CTGCAGACTGCAAGTTCACCTGCCATTACCGTTGTCGCGCGCTCGTCTGCTTGGACTGCTGCGGGCCCCGAGACCTGGGCTGGGACTCTGCACTAGAGCG

GGATACGAACGTG - UNI2968 - - UNI19406 - GATGAGGCTGTAGAGCGGGAGACACCCGATCTTTCTCAAGCTGAGACTGAGCAGAAAATCA

AGGACTACAATGGCCAGATCAACAGCAACCTCTTCATGAGCCTG - UNI18078 - AATAAGGATGGCTCCTACACAGGCTTCATCAAGGTTCAGCTG

AAACTAGTGCGTCCTGTTTCAGTGCCTTCCAGCAAGAAACCACCTTCCTTACAGGACGCCCGGAGAGGTACGGGGCGGAGCACAGCCGTGAAGCGCCGCA

CCTCTTTTTACTTGCCTAAGGATGCTATTAAGCATCTGCATGTTCTATCACGAACACGGGCACGTGAGGTCATTGAGGCCCTGCTTCGAAAATTCATGGT

CGTAGATGATCCTCGCAAGTTTGCACTCTTTGAGCGAACTGAACGGCATGGCCAAG TATACCTCCGGAAGCTGTCGGATGACGAGCAGCCCTTGAAGCT

GCGGCTTCTTGCAGGGCCCAGTGAAAAAGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCGGGAGAGGTGAAC TGGGATGCCTTCAGCATGCCTGAACT

GCACAATTTCCTACGAATCCTGCAGCGGGAAGAAGAGGAACACCTTCGCCAGATCCTGCAGAAGTATTCTCGTTGTCGCCAGAAGATCCAGGAGGCTCTG

CACGCCTGTCCTTTGGGGTGACCTTGGGTCTCCATGGATGACAGGAGGAGAACAGGCAGTGCAAAGAGCGTGCCGTGTGAGTGTGACAGGGCCTGTGGGG

CCTGAGGAGTGCGTGTGCATGGAGGTCCTCCTCTGCTGACCGGGATGAGCCCAGAGAACAGGGAAAGAGCCAGCCGTCTACCTGTGGATATAGTGGGGCG

GGGCTTTGCATCCCTCTGCCCGTATGTACTGGGTCATACTCTGCGTAGCTGCTCAAGTCACAGGGTCGCAGCTGTGAGAATCTTAGAGACTCTACAGACA

AAACAAGGTTATATTTTCACGGGTAAGAGACCTTACCTATGGAGAAAGATTGTTTTGAGTCATGAATGGGTCTCAGGATAGCCCTATCAGAGCCAAGGGT

AGCTGCTCAGAATAATACAAGCAATTAAGGTAGAGTCTGGGGTTCCCTCTTACCGTGCCTTCTGACTTCCAAACAAACACCCTGGGGTCAGAGAGGGCTG

GCCAGTACAACAACTACAGTGGCTCAGTCAGTGCCTCCTCTAAGGGAAAGGTTGCTGGACCAGACCCTCTTCTTGTTTGCCAAAGCCAGAGTCTCCCTCA

GATATTTTTGATGGAAGTGTATGAATGTATGTAATGTTTTGTGGCCTCAACTGAATGTGGGGAAGGGATGGGGGTGTGACAGTCATCATCAGGGCCTGAT

GCCTGAGAGAATTGGCTGAATAAAGATGTAAGAATTTTT
Translation
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPTTHTWCDLCGDFIWGVVRKGLQCAP - UNI31817 - PL

SADCKFTCHYRCRALVCLDCCGPRDLGWDSALERDTNV - UNI2968 - - UNI19406 - DEAVERETPDLSQAETEQKIKDYNGQINSNLFMSL 

- UNI18078 - NKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPRK

FALFERTERHGQV VYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVN WDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACP

LG
Transcript ENSMUST00000093786
Sequence
ATGTCGGCGGAGCCAGAACTCATTGAACTACGCGAGCTGGCACCGTCCGGGCGCATCGGTCCAGGCCGTACCCGGCTGGAGCGTGCCAACGCTCTGCGCA

TCGCCCCGGGTACAACACGCAATCCGTCACAGCAGCACGTCCCGGGTCGTGGCCACCGTTTCCAGCCTGCAGGGCCCACCACGCACACGTGGTGCGACCT

CTGTGGAGACTTCATCTGGGGCGTCGTGCGCAAGGGCCTACAGTGCGCGC - UNI31817 - ACTGCAAGTTCACCTGCCATTACCGTTGTCGCGCGC

TCGTCTGCTTGGACTGCTGCGGGCCCCGAGACCTGGGCTGGGACTCTGCACTAGAGCGGGATACGAACGTG - UNI2968 - - UNI19406 - GAT

GAGGCTGTAGAGCGGGAGACACCCGATCTTTCTCAAGCTGAGACTGAGCAGAAAATCAAGGACTACAATGGCCAGATCAACAGCAACCTCTTCATGAGCC

TG - UNI18078 - AATAAGGATGGCTCCTACACAGGCTTCATCAAGGTTCAGCTGAAACTAGTGCGTCCTGTTTCAGTGCCTTCCAGCAAGAAACCA

CCTTCCTTACAGGACGCCCGGAGAGGTACGGGGCGGAGCACAGCCGTGAAGCGCCGCACCTCTTTTTACTTGCCTAAGGATGCTATTAAGCATCTGCATG

TTCTATCACGAACACGGGCACGTGAGGTCATTGAGGCCCTGCTTCGAAAATTCATGGTCGTAGATGATCCTCGCAAGTTTGCACTCTTTGAGCGAACTGA

ACGGCATGGCCAAG TATACCTCCGGAAGCTGTCGGATGACGAGCAGCCCTTGAAGCTGCGGCTTCTTGCAGGGCCCAGTGAAAAAGCCCTGAGCTTTGT

CCTGAAGGAAAATGACTCGGGAGAGGTGAAC TGGGATGCCTTCAGCATGCCTGAACTGCACAATTTCCTACGAATCCTGCAGCGGGAAGAAGAGGAACA

CCTTCGCCAGATCCTGCAGAAGTATTCTCGTTGTCGCCAGAAGATCCAGGAGGCTCTGCACGCCTGTCCTTTGGGGTGACCTTGGGTCTCCATGGATGAC

AGGAGGAGAACAGGCAGTGCAAAGAGCGTGCCGTGTGAGTGTGACAGGGCCTGTGGGGCCTGAGGAGTGCGTGTGCATGGAGGTCCTCCTCTGCTGACCG

GGATGAGCCCAGAGAACAGGGAAAGAGCCAGCCGTCTACCTGTGGATATAGTGGGGCGGGGCTTTGCATCCCTCTGCCCGTATGTACTGGGTCATACTCT

GCGTAGCTGCTCAAGTCACAGGGTCGCAGCTGTGAGAATCTTAGAGACTCTACAGACAAAACAAGGTTATATTTTCACGGGTAAGAGACCTTACCTATGG

AGAAAGATTGTTTTGAGTCATGAATGGGTCTCAGGATAGCCCTATCAGAGCCAAGGGTAGCTGCTCAGAATAATACAAGCAATTAAGGTAGAGTCTGGGG

TTCCCTCTTACCGTGCCTTCTGACTTCCAAACAAACACCCTGGGGTCAGAGAGGGCTGGCCAGTACAACAACTACAGTGGCTCAGTCAGTGCCTCCTCTA

AGGGAAAGGTTGCTGGACCAGACCCTCTTCTTGTTTGCCAAAGCCAGAGTCTCCCTCAGATATTTTTGATGGAAGTGTATGAATGTATGTAATGTTTTGT

GGCCTCAACTGAATGTGGGGAAGGGATGGGGGTGTGACAGTCATCATCAGGGCCTGATGCCTGAGAGAATTGGCTGAATAAAGATGTAAGAATT
Translation
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPTTHTWCDLCGDFIWGVVRKGLQCAH - UNI31817 - HC

KFTCHYRCRALVCLDCCGPRDLGWDSALERDTNV - UNI2968 - - UNI19406 - DEAVERETPDLSQAETEQKIKDYNGQINSNLFMSL - UN

I18078 - NKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALF

ERTERHGQV VYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVN WDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG

For any suggestions or comments, please send an email to unitrap@crg.es