Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010342 (Tex14)
Chromosomal location
Chr 11: 87218567 - 87369325 (+)
Description
testis expressed gene 14 Gene [Source:MGI (curated);Acc:Tex14-001]
RefSeq_peptide
NP_113563.2 
UniGene
Mm.440758 
MGI
MGI:1933227 
Uniprot/SWISSPROT
Q7M6U3 
Uniprot/SPTREMBL
B2KGL0 Q5ND21 Q5ND20 
Human Ortholog
not available
Omim not available
UniTrap UNI11764
Vector Insertion
Chr 11: 87218673 - 87247310
Public Clones (sanger) A037D07 (ggtc) 3SD148F01 (ggtc) E125G04 (ggtc) 5SD088A03 (ggtc)
5SE041A03 (ggtc) IST12442C5 (tigm) IST11643H11 (tigm) IST14950G9 (tigm)
IST12044H10 (tigm) IST12778A3 (tigm) IST14188G3 (tigm) IST11934G1 (tigm)
IST11197G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17867
Vector Insertion
Chr 11: 87247311 - 87247448
Public Clones not available
Private Clones OST434633 (lexicon) OST409213 (lexicon) OST406731 (lexicon) OST403347 (lexicon)
OST401988 (lexicon) OST378718 (lexicon) OST367769 (lexicon) OST365096 (lexicon)
OST345748 (lexicon) OST318332 (lexicon) OST309939 (lexicon) OST296027 (lexicon)
OST289095 (lexicon) OST287767 (lexicon) OST279953 (lexicon) OST278296 (lexicon)
OST223981 (lexicon) OST219386 (lexicon) OST188747 (lexicon) OST176436 (lexicon)
OST175920 (lexicon) OST174932 (lexicon) OST173747 (lexicon) OST154727 (lexicon)
OST140321 (lexicon) OST137923 (lexicon) OST113024 (lexicon) OST109295 (lexicon)
OST100241 (lexicon) OST88607 (lexicon) OST58826 (lexicon) OST42664 (lexicon)
OST38792 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14388
Vector Insertion
Chr 11: 87247448 - 87287905
Public Clones FHCRC-GT-S15-7B1 (fhcrc) IST13566F11 (tigm) IST12668B3 (tigm) IST14786D9 (tigm)
IST11310A10 (tigm) IST13211E3 (tigm) IST14927H8 (tigm)
Private Clones OST56355 (lexicon) OST35786 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31479
Vector Insertion
Chr 11: 87288021 - 87298201
Public Clones IST10820E9 (tigm) IST10582D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35874
Vector Insertion
Chr 11: 87298368 - 87299750
Public Clones IST13305H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27950
Vector Insertion
Chr 11: 87308585 - 87309701
Public Clones not available
Private Clones OST43428 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12536
Vector Insertion
Chr 11: 87333156 - 87333240
Public Clones W072F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010486
Sequence
ATGTCTCGGGGGGCTCCTTTTCCAGTCCCTTGCCCGGTGCTGCTGGGGACCTTCACAGATGACTCCCTGGAGGCTCAGCTTCACGAATACGCCAAGCAAG

GGAACTGCGTGAAGCTCAAGAAGATTCTTAAGAAGG - UNI14388 - - UNI17867 - GAGTCTGTGTCGATGCAGTTAACACTCAGGGCCAGTC

AGCGCTCTTTGTTGCAGCATTACTGGGCCATGTGAAATTAGTGGATGTTCTGGTGGATTATGGATCAGATCCAAATCA - UNI31479 - CCGCTGCT

TTGACGGGAGCACTCCTGTCCATGCAGCAGCCTTTTCAGGCAACCAGTGGATCCTCAGTAAACTGCTGACTGCAGGGGGTGACCTGCGACTCCATGATGA

GAAGGGTCGGAATCCACAGGCCTGGGCCTTGACAGCAGGGAAGGATCGTAGCACTCAG ATGGTGGAGTTCATGCAACGTTGTACTTCACATATGAAGGC

TATCATCCAGGGCTTCTCCTATGACCTTCTGAAGAAGATAGACTCTCCTCAGCGACTCATCGGCAGCCCACCCTGGTTTGGTAGCCTCATTCAGGG AAG

CCCAAATAGTTCTCCCAACCGACAGCTTAAACCTGGAATCATTTCTGCCCAAAATATCTACAGCTTTGGCTTTGGGAAG TTTTATCTCACCTCAGGGAT

GCAGCTTACTTACCCAGGATCTCTTCCAGTCATTGGAGAGAAGGAAGTGGTCCAGGCTGATGATGAGCCCACCTTCTCTTTCTTCAGTGGCCCCTACATG

GTCATGACTAA - UNI27950 - CCTCGTGTGGAATAGGAGCAGAGTCACAGTAAAGGAGCTGAACCTTCCCACCCGTCCCCACTGTAGCAGGCTGAG

GTTGGCCGACTTGCTGATTGCTGAGCAGGAGCACAGCAG CAACCTGCGGCATCCTAACCTGCTGCAACTGATGGCTGTATGTTTGTCCCGGGACCTGGA

GAAAATTCGCCTGGTTTACGAGCGTATCACAGTCGGCACACTGTTCAGTGTCCTCCATGAACGA AGGTCCCAGTTCCCAGTGCTGCACATGGAGGTGAT

TGTGCACCTGTTGCTCCAGGTTGCTGATGCCTTGATATACCTGCATTCCCGGGGGTTCATCCACCGCTCCCTCAGCTCCTACGCTGTCCACATCGTCTCT

GCAGGAGAAGCAAGGCTGACTAACCTGGAATACCTGACGGAAAG CCAGGACAGTGGTGCACACAGGAACGTGACTCGAATGCCCCTCCCCACCCAGCTG

TACAACTGGGCTGCACCAGAAGTGGTCTTGCAGAAGGCAGCCACGGTGAAGTCAGACATATACAGCTTTTCCGTGATCATACAAGAGATCTTAACAG AC

AGTATACCCTGGAATGGCTTGGATGGCTCACTTGTTAAAGAAACCATAGCCTTGGGAAATTATTTAGAAGCTGATGTCAGGCTTCCGGAACCTTACTATG

ATATTGTTAAGTCAGGAATCCATGCCAAGCAGAAGAACCGAACAATGAACCTTCAAGATATTCGTTATATTCTGAAGAATGACTTAAAG GAATTTATTG

GAGCTCAGAAAACTCAGCCAACCGAGAGCCCCAGAGGGCAGAGCTATGAACCCCATCCTGATGTTAATATCTGCCTAGGTCTAACTTCAGAATATCAAAA

GGACCCTCCAGACTTGGACATCAAGGAACTAAAGGAAATGG GTAGTCAGCCCCATTCACCTACAGATCACTCCTTTCTCACTGTAAAACCAACACTAGC

TCCTCAGACCCTAGATTCAAGTCTGTCAGCCCAGAAACCTGACAATGCAAATGTTCCTTCTCCTCCTGCTGCATGTCTGGCAGAAGAGGTCAGGAGCCCC

ACTGCAAGTCAGGACAGCCTCTGCAGCTTTGAAATCAATGAGATCTACTCAGGCTGCTTGACACTGGGAACTGACAAGGAGGAAGAGTGTCTGGGGACTG

CTGCTTCACCTGAGGGGGATAGACCAAACCAGGGAGATGAGCTGCCATCCCTGGAAGAAGAGCTCGATAAGATGGAGAGAGAATTGCACTGTTTTTGTGA

AGAGGACAAAAGCATTTCAGAAGTTGACACAGACCTTCTTTTTGAGGATGATGACTGGCAAAGTGATTCTCTTGGTTCACTCAACCTGCCCGAACCAACC

AGAGAAGCCAAGGGCAAAACGAGCAGCTGGTCCAAGACTGATGAGTATGTCAGTAAGTGTGTGCTGAATCTGAAGATTTCACAGGTGATGATGCAGCAGA

GCGCTGAGTGGCTGAGGAAGCTTGAGCAGGAGGTAGAGGAGCTCGAGTGGGCACAGAAGGAGCTGGACAGTCAGTGCAGCAGTTTGCGGGATGCTTCATT

AAAGTTTGCAAATGCCAAGTTCCAGCCGGCTGTAGGCCCTCCATCTTTGGCCTATCTTCCTCCTGTTATGCAATTACCAGGGCTCAAGCAGCCTGAAAAT

GGTGGCACCTGGTTAACCCTAGCAAGGTCTCCAGGAAATGAGAGAGAGTTCCAAGAGGGACATTTTAGCAAAAAACCTGAGAAACTAAGTGCCTGTGGCT

GGAAGCCTTTTACACAAGTGTCTGAAGAAAGCAGAGGGGACTGCTCAGAGCTAAACAATCAG CTGCCGACTCTTCGTGGTCCTGGGAAGCAGAGCACAG

GTGAGCAGTTACCATCCACTCAAGAAGCAAGGGAGAGTTTGGAAAAAAATACAAACCAAAATAGTAGGAG - UNI12536 - TATGGCGTCTGTGTCT

TCTGAAATCTATGCTACTAAGTCAAGAAATAATGAGGATAATGGAGAGGCACACTTGAAATGGAGAT - UNI12536 - TGGCAGTAAAAGAAATGGC

AGAGAAAGCAGTTTCCGGACAGCTCTTATTACCTCCTTGGAATCCTCAGAGTAGTGCGCCTTTTGAGAGTAAGGTTGAAAATGAGAGCACTCCTTTGCCA

CGGCCCCCAATTAGAGGTCCTGAGAGCACAGAATGGCAGCACATTTTAGAATACCAGAGGGAAAATGATGAGCCCAAAGGAAATACGAAGTTTGGCAAAA

TGGACAACAGTGACTGTGACAAGAACAAGCACAGCAGATGGACAGGCCTCCAGCGCTTCACTG GTATTAGATACCCATTCTTCAGAAACCACGAGCAGC

CAGAGCAGAATGAAGCCTCTCAAGCAAGCTGTGACACGTCTGTGGGCACTGAGAAGTTCTACAGC ACCTCAAGTCCCATAGGAGACGACTTTGAAAGAT

TCCAAGATTCTTTTGCCCAACGTCAAGGCTATG TTGAAGAAAATTTCCAAATAAGAGAAATATTTGAAAAGAATGCTGAGATTTTGACCAAGCCTCAGT

TTCAAGCTATTCAATG TGCTGAAGACAAACAAGACGAAACATTAGGGGAGACGCCAAAGGAACTGAAAGAGAAAAACAC ATCACTGACAGACATTCAA

GACTTGTCCAGCATCACCTATGATCAAGACGGCTATTTTAAGGAAACCTCATACAAAACACCCAAATTAAAACACGCACCAACTAGTGCCAGTACCCCGC

TAAGCCCAG AGTCGATTTCTTCAGCTGCTAGTCACTATGAAGACTGCCTTGAAAATACCACATTTCATGTTAAAAGAGGATCTACATTTTGTTGGAATG

GCCAAGAAGCTATGAGAACTTTGTCTGCCAAATTTACAACTGTCCGAGAGAGAGCTAAGAGCCTGGAATCACTTCTCGCTTCTTCTAAAAGCCTACCTGC

CAAGCTGACTGACTCC AAGAGATTGTGTATGTTGAGTGAGACTGGCTCTTCTAACGTTTCTGCGGCATTTGTAACATCAACTCATGCTACCAAGAGGAA

GAGCCTACCCAGAG AACTGGCAGAAGCCACCTCTCAACAGCATCTTGATGAGCTTCCACCACCAGCTCAGGAGCTACTTGATGAAATTG AGCAACTGA

AGCAGCAGCAGGTCTCATCCCTGGCGTCACATGAGAACACGGCACGTGATCTGAGTGTCACTAACAAGG ATAAGAAGCATTTGGAAGAACAAGAAACCA

ACAGTAGTAAAGACAGCAGTTTTCTTTCCAGCAGAGAAATTCAGGATCTGGAAGATACAGAGAG AGCTCATTCTTCTCTTGATGAGGACCTGGAAAGAT

TCCTGCAGTCACCTGAGGAGAACACGGCACTGCTGGACCCTACCAAGGGCTCTACAAG GGAGAAAAAAAACAAAGATCAAGACGTTGTTGAGCAGAAGA

GAAAAAAGAAAGAAAGCATCAAGCCAGAGAGAAGGGAGTCAGACAGCTCCCTAGGGACCTTGGAAGAAG ATGAACTAAAACCCTGTTTTTGGAAGCGAC

TGGGTTGGTCCGAACCTTCCAG GATAATTGTGCTGGATCAGAGCGACTTGTCAGACTGATTGGAACTGGACCGTGCAAGCATTGTGGCTGTGGCCTCCT

TTCTTCTCTTATCTGCTTCAGTTGCCTCAAGGACAGTAGTTTCAGTCTGTAACTCACACTTTGTTCTGCTGCTACTATGGGCACAATAATGTGTCCCTAT

CATGTGTAGCATGCTTAATCATTTGTTTTAAATCAGGTTTCTGAAAAGTGCAAAGTAACCATAGTGGCAAACATTTTGTGTTCAGAATGGCTTTTGTTTT

TTCTGATGTAAATTTTTGAAACCATAACTTTGTTATATAATAAAGTGTTTACTTTCAATGCT
Translation
MSRGAPFPVPCPVLLGTFTDDSLEAQLHEYAKQGNCVKLKKILKKG - UNI14388 - - UNI17867 - GVCVDAVNTQGQSALFVAALLGHVKLV

DVLVDYGSDPNH - UNI31479 - HRCFDGSTPVHAAAFSGNQWILSKLLTAGGDLRLHDEKGRNPQAWALTAGKDRSTQ MVEFMQRCTSHMKAIIQ

GFSYDLLKKIDSPQRLIGSPPWFGSLIQG GSPNSSPNRQLKPGIISAQNIYSFGFGK FYLTSGMQLTYPGSLPVIGEKEVVQADDEPTFSFFSGPYMV

MTN - UNI27950 - NLVWNRSRVTVKELNLPTRPHCSRLRLADLLIAEQEHSS SNLRHPNLLQLMAVCLSRDLEKIRLVYERITVGTLFSVLHER 

RSQFPVLHMEVIVHLLLQVADALIYLHSRGFIHRSLSSYAVHIVSAGEARLTNLEYLTES SQDSGAHRNVTRMPLPTQLYNWAAPEVVLQKAATVKSDI

YSFSVIIQEILTD DSIPWNGLDGSLVKETIALGNYLEADVRLPEPYYDIVKSGIHAKQKNRTMNLQDIRYILKNDLK EFIGAQKTQPTESPRGQSYEP

HPDVNICLGLTSEYQKDPPDLDIKELKEMG GSQPHSPTDHSFLTVKPTLAPQTLDSSLSAQKPDNANVPSPPAACLAEEVRSPTASQDSLCSFEINEIY

SGCLTLGTDKEEECLGTAASPEGDRPNQGDELPSLEEELDKMERELHCFCEEDKSISEVDTDLLFEDDDWQSDSLGSLNLPEPTREAKGKTSSWSKTDEY

VSKCVLNLKISQVMMQQSAEWLRKLEQEVEELEWAQKELDSQCSSLRDASLKFANAKFQPAVGPPSLAYLPPVMQLPGLKQPENGGTWLTLARSPGNERE

FQEGHFSKKPEKLSACGWKPFTQVSEESRGDCSELNNQ LPTLRGPGKQSTGEQLPSTQEARESLEKNTNQNSRS - UNI12536 - SMASVSSEIYA

TKSRNNEDNGEAHLKWRL - UNI12536 - LAVKEMAEKAVSGQLLLPPWNPQSSAPFESKVENESTPLPRPPIRGPESTEWQHILEYQRENDEPKGN

TKFGKMDNSDCDKNKHSRWTGLQRFTG GIRYPFFRNHEQPEQNEASQASCDTSVGTEKFYS TSSPIGDDFERFQDSFAQRQGYV VEENFQIREIFEK

NAEILTKPQFQAIQC CAEDKQDETLGETPKELKEKNT TSLTDIQDLSSITYDQDGYFKETSYKTPKLKHAPTSASTPLSPE ESISSAASHYEDCLEN

TTFHVKRGSTFCWNGQEAMRTLSAKFTTVRERAKSLESLLASSKSLPAKLTDS KRLCMLSETGSSNVSAAFVTSTHATKRKSLPRE ELAEATSQQHLD

ELPPPAQELLDEIE EQLKQQQVSSLASHENTARDLSVTNKD DKKHLEEQETNSSKDSSFLSSREIQDLEDTER RAHSSLDEDLERFLQSPEENTALL

DPTKGSTR REKKNKDQDVVEQKRKKKESIKPERRESDSSLGTLEED DELKPCFWKRLGWSEPSR RIIVLDQSDLSD
Transcript ENSMUST00000060835
Sequence
ACAGCTTCCGGTGGGTGACCCCGGGACTCCGGAGCTCCCTCAGAGTGTGGCGGTTTCTGAGCATTCATGTCGGCAGGCCTGCCTAGAGTAAGAAGTAGCT

GGAAAA - UNI11764 - CATGTCTCGGGGGGCTCCTTTTCCAGTCCCTTGCCCGGTGCTGCTGGGGACCTTCACAGATGACTCCCTGGAGGCTCAGC

TTCACGAATACGCCAAGCAAGGGAACTGCGTGAAGCTCAAGAAGATTCTTAAGAAGG - UNI14388 - - UNI17867 - GAGTCTGTGTCGATGC

AGTTAACACTCAGGGCCAGTCAGCGCTCTTTGTTGCAGCATTACTGGGCCATGTGAAATTAGTGGATGTTCTGGTGGATTATGGATCAGATCCAAATCA 

- UNI31479 - CCGCTGCTTTGACGGGAGCACTCCTGTCCATGCAGCAGCCTTTTCAGGCAACCAGTGGATCCTCAGTAAACTGCTGACTGCAGGGGG

TGACCTGCGACTCCATGATGAGAAGGGTCGGAATCCACAGGCCTGGGCCTTGACAGCAGGGAAGGATCGTAGCACTCAG ATGGTGGAGTTCATGCAACG

TTGTACTTCACATATGAAGGCTATCATCCAGGGCTTCTCCTATGACCTTCTGAAGAAGATAGACTCTCCTCAGCGACTCATCGGCAGCCCACCCTGGTTT

GGTAGCCTCATTCAGGG AAGCCCAAATAGTTCTCCCAACCGACAGCTTAAACCTGGAATCATTTCTGCCCAAAATATCTACAGCTTTGGCTTTGGGAAG

 TTTTATCTCACCTCAGGGATGCAGCTTACTTACCCAGGATCTCTTCCAGTCATTGGAGAGAAGGAAGTGGTCCAGGCTGATGATGAGCCCACCTTCTCT

TTCTTCAGTGGCCCCTACATGGTCATGACTAA - UNI27950 - CCTCGTGTGGAATAGGAGCAGAGTCACAGTAAAGGAGCTGAACCTTCCCACCCG

TCCCCACTGTAGCAGGCTGAGGTTGGCCGACTTGCTGATTGCTGAGCAGGAGCACAGCAG CAACCTGCGGCATCCTAACCTGCTGCAACTGATGGCTGT

ATGTTTGTCCCGGGACCTGGAGAAAATTCGCCTGGTTTACGAGCGTATCACAGTCGGCACACTGTTCAGTGTCCTCCATGAACGA AGGTCCCAGTTCCC

AGTGCTGCACATGGAGGTGATTGTGCACCTGTTGCTCCAGGTTGCTGATGCCTTGATATACCTGCATTCCCGGGGGTTCATCCACCGCTCCCTCAGCTCC

TACGCTGTCCACATCGTCTCTGCAGGAGAAGCAAGGCTGACTAACCTGGAATACCTGACGGAAAG CCAGGACAGTGGTGCACACAGGAACGTGACTCGA

ATGCCCCTCCCCACCCAGCTGTACAACTGGGCTGCACCAGAAGTGGTCTTGCAGAAGGCAGCCACGGTGAAGTCAGACATATACAGCTTTTCCGTGATCA

TACAAGAGATCTTAACAG ACAGTATACCCTGGAATGGCTTGGATGGCTCACTTGTTAAAGAAACCATAGCCTTGGGAAATTATTTAGAAGCTGATGTCA

GGCTTCCGGAACCTTACTATGATATTGTTAAGTCAGGAATCCATGCCAAGCAGAAGAACCGAACAATGAACCTTCAAGATATTCGTTATATTCTGAAGAA

TGACTTAAAG GAATTTATTGGAGCTCAGAAAACTCAGCCAACCGAGAGCCCCAGAGGGCAGAGCTATGAACCCCATCCTGATGTTAATATCTGCCTAGG

TCTAACTTCAGAATATCAAAAGGACCCTCCAGACTTGGACATCAAGGAACTAAAGGAAATGG GTAGTCAGCCCCATTCACCTACAGATCACTCCTTTCT

CACTGTAAAACCAACACTAGCTCCTCAGACCCTAGATTCAAGTCTGTCAGCCCAGAAACCTGACAATGCAAATGTTCCTTCTCCTCCTGCTGCATGTCTG

GCAGAAGAGGTCAGGAGCCCCACTGCAAGTCAGGACAGCCTCTGCAGCTTTGAAATCAATGAGATCTACTCAGGCTGCTTGACACTGGGAACTGACAAGG

AGGAAGAGTGTCTGGGGACTGCTGCTTCACCTGAGGGGGATAGACCAAACCAGGGAGATGAGCTGCCATCCCTGGAAGAAGAGCTCGATAAGATGGAGAG

AGAATTGCACTGTTTTTGTGAAGAGGACAAAAGCATTTCAGAAGTTGACACAGACCTTCTTTTTGAGGATGATGACTGGCAAAGTGATTCTCTTGGTTCA

CTCAACCTGCCCGAACCAACCAGAGAAGCCAAGGGCAAAACGAGCAGCTGGTCCAAGACTGATGAGTATGTCAGTAAGTGTGTGCTGAATCTGAAGATTT

CACAGGTGATGATGCAGCAGAGCGCTGAGTGGCTGAGGAAGCTTGAGCAGGAGGTAGAGGAGCTCGAGTGGGCACAGAAGGAGCTGGACAGTCAGTGCAG

CAGTTTGCGGGATGCTTCATTAAAGTTTGCAAATGCCAAGTTCCAGCCGGCTGTAGGCCCTCCATCTTTGGCCTATCTTCCTCCTGTTATGCAATTACCA

GGGCTCAAGCAGCCTGAAAATGGTGGCACCTGGTTAACCCTAGCAAGGTCTCCAGGAAATGAGAGAGAGTTCCAAGAGGGACATTTTAGCAAAAAACCTG

AGAAACTAAGTGCCTGTGGCTGGAAGCCTTTTACACAAGTGTCTGAAGAAAGCAGAGGGGACTGCTCAGAGCTAAACAATCAG CTGCCGACTCTTCGTG

GTCCTGGGAAGCAGAGCACAGGTGAGCAGTTACCATCCACTCAAGAAGCAAGGGAGAGTTTGGAAAAAAATACAAACCAAAATAGTAGGAG - UNI125

36 - TATGGCGTCTGTGTCTTCTGAAATCTATGCTACTAAGTCAAGAAATAATGAGGATAATGGAGAGGCACACTTGAAATGGAGAT - UNI12536 

- TGGCAGTAAAAGAAATGGCAGAGAAAGCAGTTTCCGGACAGCTCTTATTACCTCCTTGGAATCCTCAGAGTAGTGCGCCTTTTGAGAGTAAGGTTGAA

AATGAGAGCACTCCTTTGCCACGGCCCCCAATTAGAGGTCCTGAGAGCACAGAATGGCAGCACATTTTAGAATACCAGAGGGAAAATGATGAGCCCAAAG

GAAATACGAAGTTTGGCAAAATGGACAACAGTGACTGTGACAAGAACAAGCACAGCAGATGGACAGGCCTCCAGCGCTTCACTG GTATTAGATACCCAT

TCTTCAGAAACCACGAGCAGCCAGAGCAGAATGAAGCCTCTCAAGCAAGCTGTGACACGTCTGTGGGCACTGAGAAGTTCTACAGC ACCTCAAGTCCCA

TAGGAGACGACTTTGAAAGATTCCAAGATTCTTTTGCCCAACGTCAAGGCTATG TTGAAGAAAATTTCCAAATAAGAGAAATATTTGAAAAGAATGCTG

AGATTTTGACCAAGCCTCAGTTTCAAGCTATTCAATG TGCTGAAGACAAACAAGACGAAACATTAGGGGAGACGCCAAAGGAACTGAAAGAGAAAAACA

C ATCACTGACAGACATTCAAGACTTGTCCAGCATCACCTATGATCAAGACGGCTATTTTAAGGAAACCTCATACAAAACACCCAAATTAAAACACGCAC

CAACTAGTGCCAGTACCCCGCTAAGCCCAG AGTCGATTTCTTCAGCTGCTAGTCACTATGAAGACTGCCTTGAAAATACCACATTTCATGTTAAAAGAG

GATCTACATTTTGTTGGAATGGCCAAGAAGCTATGAGAACTTTGTCTGCCAAATTTACAACTGTCCGAGAGAGAGCTAAGAGCCTGGAATCACTTCTCGC

TTCTTCTAAAAGCCTACCTGCCAAGCTGACTGACTCC AAGAGATTGTGTATGTTGAGTGAGACTGGCTCTTCTAACGTTTCTGCGGCATTTGTAACATC

AACTCATGCTACCAAGAGGAAGAGCCTACCCAGAG AACTGGCAGAAGCCACCTCTCAACAGCATCTTGATGAGCTTCCACCACCAGCTCAGGAGCTACT

TGATGAAATTG AGCAACTGAAGCAGCAGCAGGTCTCATCCCTGGCGTCACATGAGAACACGGCACGTGATCTGAGTGTCACTAACAAGG ATAAGAAGC

ATTTGGAAGAACAAGAAACCAACAGTAGTAAAGACAGCAGTTTTCTTTCCAGCAGAGAAATTCAGGATCTGGAAGATACAGAGAG AGCTCATTCTTCTC

TTGATGAGGACCTGGAAAGATTCCTGCAGTCACCTGAGGAGAACACGGCACTGCTGGACCCTACCAAGGGCTCTACAAG GGAGAAAAAAAACAAAGATC

AAGACGTTGTTGAGCAGAAGAGAAAAAAGAAAGAAAGCATCAAGCCAGAGAGAAGGGAGTCAGACAGCTCCCTAGGGACCTTGGAAGAAG ATGAACTAA

AACCCTGTTTTTGGAAGCGACTGGGTTGGTCCGAACCTTCCAG GATAATTGTGCTGGATCAGAGCGACTTGTCAGACTGATTGGAACTGGACCGTGCAA

GCATTGTGGCTGTGGCCTCCTTTCTTCTCTTATCTGCTTCAGTTGCCTCAAGGACAGTAGTTTCAGTCTGTAACTCACACTTTGTTCTGCTGCTACTATG

GGCACAATAATGTGTCCCTATCATGTGTAGCATGCTTAATCATTTGTTTTAAATCAGGTTTCTGAAAAGTGCAAAGTAACCATAGTGGCAAACATTTTGT

GTTCAGAATGGCTTTTGTTTTTTCTGATGTAAATTTTTGAAACCATAACTTTGTTATATAATAAAGTGTTTACTTTCAATGCTA
Translation
 - UNI11764 - MSRGAPFPVPCPVLLGTFTDDSLEAQLHEYAKQGNCVKLKKILKKG - UNI14388 - - UNI17867 - GVCVDAVNTQGQS

ALFVAALLGHVKLVDVLVDYGSDPNH - UNI31479 - HRCFDGSTPVHAAAFSGNQWILSKLLTAGGDLRLHDEKGRNPQAWALTAGKDRSTQ MVE

FMQRCTSHMKAIIQGFSYDLLKKIDSPQRLIGSPPWFGSLIQG GSPNSSPNRQLKPGIISAQNIYSFGFGK FYLTSGMQLTYPGSLPVIGEKEVVQAD

DEPTFSFFSGPYMVMTN - UNI27950 - NLVWNRSRVTVKELNLPTRPHCSRLRLADLLIAEQEHSS SNLRHPNLLQLMAVCLSRDLEKIRLVYER

ITVGTLFSVLHER RSQFPVLHMEVIVHLLLQVADALIYLHSRGFIHRSLSSYAVHIVSAGEARLTNLEYLTES SQDSGAHRNVTRMPLPTQLYNWAAP

EVVLQKAATVKSDIYSFSVIIQEILTD DSIPWNGLDGSLVKETIALGNYLEADVRLPEPYYDIVKSGIHAKQKNRTMNLQDIRYILKNDLK EFIGAQK

TQPTESPRGQSYEPHPDVNICLGLTSEYQKDPPDLDIKELKEMG GSQPHSPTDHSFLTVKPTLAPQTLDSSLSAQKPDNANVPSPPAACLAEEVRSPTA

SQDSLCSFEINEIYSGCLTLGTDKEEECLGTAASPEGDRPNQGDELPSLEEELDKMERELHCFCEEDKSISEVDTDLLFEDDDWQSDSLGSLNLPEPTRE

AKGKTSSWSKTDEYVSKCVLNLKISQVMMQQSAEWLRKLEQEVEELEWAQKELDSQCSSLRDASLKFANAKFQPAVGPPSLAYLPPVMQLPGLKQPENGG

TWLTLARSPGNEREFQEGHFSKKPEKLSACGWKPFTQVSEESRGDCSELNNQ LPTLRGPGKQSTGEQLPSTQEARESLEKNTNQNSRS - UNI12536

 - SMASVSSEIYATKSRNNEDNGEAHLKWRL - UNI12536 - LAVKEMAEKAVSGQLLLPPWNPQSSAPFESKVENESTPLPRPPIRGPESTEWQH

ILEYQRENDEPKGNTKFGKMDNSDCDKNKHSRWTGLQRFTG GIRYPFFRNHEQPEQNEASQASCDTSVGTEKFYS TSSPIGDDFERFQDSFAQRQGYV

 VEENFQIREIFEKNAEILTKPQFQAIQC CAEDKQDETLGETPKELKEKNT TSLTDIQDLSSITYDQDGYFKETSYKTPKLKHAPTSASTPLSPE ES

ISSAASHYEDCLENTTFHVKRGSTFCWNGQEAMRTLSAKFTTVRERAKSLESLLASSKSLPAKLTDS KRLCMLSETGSSNVSAAFVTSTHATKRKSLPR

E ELAEATSQQHLDELPPPAQELLDEIE EQLKQQQVSSLASHENTARDLSVTNKD DKKHLEEQETNSSKDSSFLSSREIQDLEDTER RAHSSLDEDL

ERFLQSPEENTALLDPTKGSTR REKKNKDQDVVEQKRKKKESIKPERRESDSSLGTLEED DELKPCFWKRLGWSEPSR RIIVLDQSDLSD
Transcript ENSMUST00000092806
Sequence
TTGTACTTCACATATGAAGGCTATCATCCAGGGCTTCTCCTATGACCTTCTGAAGAAGATAGACTCTCCTCAGCGACTCATCGGCAGCCCACCCTGGTTT

GGTAGCCTCATTCAGGG AAGCCCAAATAGTTCTCCCAACCGACAGCTTAAACCTGGAATCATTTCTGCCCAAAATATCTACAGCTTTGGCTTTGGGAAG

 TTTTATCTCACCTCAGGGATGCAGCTTACTTACCCAGGATCTCTTCCAGTCATTGGAGAGAAGGAAGTGGTCCAGGCTGATGATGAGCCCACCTTCTCT

TTCTTCAGTGGCCCCTACATGGTCATGACTAA - UNI27950 - CCTCGTGTGGAATAGGAGCAGAGTCACAGTAAAGGAGCTGAACCTTCCCACCCG

TCCCCACTGTAGCAGGCTGAGGTTGGCCGACTTGCTGATTGCTGAGCAGGAGCACAGCAG CAACCTGCGGCATCCTAACCTGCTGCAACTGATGGCTGT

ATGTTTGTCCCGGGACCTGGAGAAAATTCGCCTGGTTTACGAGCGTATCACAGTCGGCACACTGTTCAGTGTCCTCCATGAACGA AGGTCCCAGTTCCC

AGTGCTGCACATGGAGGTGATTGTGCACCTGTTGCTCCAGGTTGCTGATGCCTTGATATACCTGCATTCCCGGGGGTTCATCCACCGCTCCCTCAGCTCC

TACGCTGTCCACATCGTCTCTGCAGGAGAAGCAAGGCTGACTAACCTGGAATACCTGACGGAAAG CCAGGACAGTGGTGCACACAGGAACGTGACTCGA

ATGCCCCTCCCCACCCAGCTGTACAACTGGGCTGCACCAGAAGTGGTCTTGCAGAAGGCAGCCACGGTGAAGTCAGACATATACAGCTTTTCCGTGATCA

TACAAGAGATCTTAACAG ACAGTATACCCTGGAATGGCTTGGATGGCTCACTTGTTAAAGAAACCATAGCCTTGGGAAATTATTTAGAAGCTGATGTCA

GGCTTCCGGAACCTTACTATGATATTGTTAAGTCAGGAATCCATGCCAAGCAGAAGAACCGAACAATGAACCTTCAAGATATTCGTTATATTCTGAAGAA

TGACTTAAAG GAATTTATTGGAGCTCAGAAAACTCAGCCAACCGAGAGCCCCAGAGGGCAGAGCTATGAACCCCATCCTGATGTTAATATCTGCCTAGG

TCTAACTTCAGAATATCAAAAGGACCCTCCAGACTTGGACATCAAGGAACTAAAGGAAATGG GTAGTCAGCCCCATTCACCTACAGATCACTCCTTTCT

CACTGTAAAACCAACACTAGCTCCTCAGACCCTAGATTCAAGTCTGTCAGCCCAGAAACCTGACAATGCAAATGTTCCTTCTCCTCCTGCTGCATGTCTG

GCAGAAGAGGTCAGGAGCCCCACTGCAAGTCAGGACAGCCTCTGCAGCTTTGAAATCAATGAGATCTACTCAGGCTGCTTGACACTGGGAACTGACAAGG

AGGAAGAGTGTCTGGGGACTGCTGCTTCACCTGAGGGGGATAGACCAAACCAGGGAGATGAGCTGCCATCCCTGGAAGAAGAGCTCGATAAGATGGAGAG

AGAATTGCACTGTTTTTGTGAAGAGGACAAAAGCATTTCAGAAGTTGACACAGACCTTCTTTTTGAGGATGATGACTGGCAAAGTGATTCTCTTGGTTCA

CTCAACCTGCCCGAACCAACCAGAGAAGCCAAGGGCAAAACGAGCAGCTGGTCCAAGACTGATGAGTATGTCAGTAAGTGTGTGCTGAATCTGAAGATTT

CACAGGTGATGATGCAGCAGAGCGCTGAGTGGCTGAGGAAGCTTGAGCAGGAGGTAGAGGAGCTCGAGTGGGCACAGAAGGAGCTGGACAGTCAGTGCAG

CAGTTTGCGGGATGCTTCATTAAAGTTTGCAAATGCCAAGTTCCAGCCGGCTGTAGGCCCTCCATCTTTGGCCTATCTTCCTCCTGTTATGCAATTACCA

GGGCTCAAGCAGCCTGAAAATGGTGGCACCTGGTTAACCCTAGCAAGGTCTCCAGGAAATGAGAGAGAGTTCCAAGAGGGACATTTTAGCAAAAAACCTG

AGAAACTAAGTGCCTGTGGCTGGAAGCCTTTTACACAAGTGTCTGAAGAAAGCAGAGGGGACTGCTCAGAGCTAAACAATCAG CTGCCGACTCTTCGTG

GTCCTGGGAAGCAGAGCACAGGTGAGCAGTTACCATCCACTCAAGAAGCAAGGGAGAGTTTGGAAAAAAATACAAACCAAAATAGTAGGAG - UNI125

36 - TATGGCGTCTGTGTCTTCTGAAATCTATGCTACTAAGTCAAGAAATAATGAGGATAATGGAGAGGCACACTTGAAATGGAGAT - UNI12536 

- TGGCAGTAAAAGAAATGGCAGAGAAAGCAGTTTCCGGACAGCTCTTATTACCTCCTTGGAATCCTCAGAGTAGTGCGCCTTTTGAGAGTAAGGTTGAA

AATGAGAGCACTCCTTTGCCACGGCCCCCAATTAGAGGTCCTGAGAGCACAGAATGGCAGCACATTTTAGAATACCAGAGGGAAAATGATGAGCCCAAAG

GAAATACGAAGTTTGGCAAAATGGACAACAGTGACTGTGACAAGAACAAGCACAGCAGATGGACAGGCCTCCAGCGCTTCACTG GTATTAGATACCCAT

TCTTCAGAAACCACGAGCAGCCAGAGCAGAATGAAGCCTCTCAAGCAAGCTGTGACACGTCTGTGGGCACTGAGAAGTTCTACAGC ACCTCAAGTCCCA

TAGGAGACGACTTTGAAAGATTCCAAGATTCTTTTGCCCAACGTCAAGGCTATG TTGAAGAAAATTTCCAAATAAGAGAAATATTTGAAAAGAATGCTG

AGATTTTGACCAAGCCTCAGTTTCAAGCTATTCAATG TGCTGAAGACAAACAAGACGAAACATTAGGGGAGACGCCAAAGGAACTGAAAGAGAAAAACA

C ATCACTGACAGACATTCAAGACTTGTCCAGCATCACCTATGATCAAGACGGCTATTTTAAGGAAACCTCATACAAAACACCCAAATTAAAACACGCAC

CAACTAGTGCCAGTACCCCGCTAAGCCCAG AGTCGATTTCTTCAGCTGCTAGTCACTATGAAGACTGCCTTGAAAATACCACATTTCATGTTAAAAGAG

GATCTACATTTTGTTGGAATGGCCAAGAAGCTATGAGAACTTTGTCTGCCAAATTTACAACTGTCCGAGAGAGAGCTAAGAGCCTGGAATCACTTCTCGC

TTCTTCTAAAAGCCTACCTGCCAAGCTGACTGACTCC AAGAGATTGTGTATGTTGAGTGAGACTGGCTCTTCTAACGTTTCTGCGGCATTTGTAACATC

AACTCATGCTACCAAGAGGAAGAGCCTACCCAGAG ATAAGAAGCATTTGGAAGAACAAGAAACCAACAGTAGTAAAGACAGCAGTTTTCTTTCCAGCAG

AGAAATTCAGGATCTGGAAGATACAGAGAG AGCTCATTCTTCTCTTGATGAGGACCTGGAAAGATTCCTGCAGTCACCTGAGGAGAACACGGCACTGCT

GGACCCTACCAAGGGCTCTACAAG GGAGAAAAAAAACAAAGATCAAGACGTTGTTGAGCAGAAGAGAAAAAAGAAAGAAAGCATCAAGCCAGAGAGAAG

GGAGTCAGACAGCTCCCTAGGGACCTTGGAAGAAG ATGAACTAAAACCCTGTTTTTGGAAGCGACTGGGTTGGTCCGAACCTTCCAG GATAATTGTGC

TGGATCAGAGCGACTTGTCAGACTGATTGGAACTGGACCGTGCAAGCATTGTGGCTGTGGCCTCCTTTCTTCTCTTATCTGCTTCAGTTGCCTCAAGGAC

AGTAGTTTCAGTCTGTAACTCACACTTTGTTCTGCTGCTACTATGGGCACAATAATGTGTCCCTATCATGTGTAGCATGCTTAATCATTTGTTTTAAATC

AGGTTTCTGAAAAGTGCAAAGTAACCATAGTGGCAAACATTTTGTGTTCAGAATGGCTTTTGTTTTTTCTGATGTAAATTTTTGAAACCATAACTTTGTT

ATATAATAAAGTGTTTACTTTCAATGCT
Translation
   - UNI27950 -         - UNI12536 -  - UNI12536 - MDNSDCDKNKHSRWTGLQRFTG GIRYPFFRNHEQPEQNEASQASCDTS

VGTEKFYS TSSPIGDDFERFQDSFAQRQGYV VEENFQIREIFEKNAEILTKPQFQAIQC CAEDKQDETLGETPKELKEKNT TSLTDIQDLSSITYD

QDGYFKETSYKTPKLKHAPTSASTPLSPE ESISSAASHYEDCLENTTFHVKRGSTFCWNGQEAMRTLSAKFTTVRERAKSLESLLASSKSLPAKLTDS 

KRLCMLSETGSSNVSAAFVTSTHATKRKSLPRD DKKHLEEQETNSSKDSSFLSSREIQDLEDTER RAHSSLDEDLERFLQSPEENTALLDPTKGSTR 

REKKNKDQDVVEQKRKKKESIKPERRESDSSLGTLEED DELKPCFWKRLGWSEPSR RIIVLDQSDLSD
Transcript ENSMUST00000100657
Sequence
GAAGCCACCTCTCAACAGCATCTTGATGAGCTTCCACCACCAGCTCAGGAGCTACTTGATGAAATTG ATGAACTAAAACCCTGTTTTTGGAAGCGACTG

GGTTGGTCCGAACCTTCCAG GATAATTGTGCTGGATCAGAGCGACTTGTCAGACTGATTGGAACTGGACCGTGCAAGCATTGTGGCTGTGGCCTCCTTT

CTTCTCTTATCTGCTTCAGTTGCCTCAAGGACAGTAGTTTCAGTCTGTAACTCACACTTTGTTCTGCTGCTACTATGGGCACAATAATGTGTCCCTATCA

TGTGTAGCATGCTTAATCATTTGTTTTAAATCAGGTTTCTGAAAAGTGCAAAGTAACCATAGTGGCAAACATTTTGTGTTCAGAATGGCTTTTGTTTTTT

CTGATGTAAATTTTTGAAACCATAACTTTGTTATATAATAAAGTGTTTACTTTCAATGCT
Translation
EATSQQHLDELPPPAQELLDEID DELKPCFWKRLGWSEPSR RIIVLDQSDLSD

For any suggestions or comments, please send an email to unitrap@crg.es