Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010406 (Mrpl52)
Chromosomal location
Chr 14: 55045747 - 55048590 (+)
Description
mitochondrial ribosomal protein L52 Gene [Source:MGI Symbol;Acc:MGI:1916086]
RefSeq_dna
NM_026851 
RefSeq_peptide
NP_081127.1 
MGI
MGI:1916086 
Uniprot/SWISSPROT
Q9D0Y8 
Human Ortholog
ENSG00000172590 (MRPL52)
Omim not available
UniTrap UNI32048
Vector Insertion
Chr 14: 55045798 - 55045870
Public Clones IST10655G6 (tigm) IST10435C8 (tigm) IST14581D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19446
Vector Insertion
Chr 14: 55045929 - 55046007
Public Clones IST13138A2 (tigm) IST10655G6 (tigm)
Private Clones OST391014 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11558
Vector Insertion
Chr 14: 55046076 - 55047420
Public Clones (sanger) D070E07 (ggtc) P068E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17000
Vector Insertion
Chr 14: 55047486 - 55048418
Public Clones CMHD-GT_363B3-3 (cmhd)
Private Clones OST451068 (lexicon) OST417351 (lexicon) OST337435 (lexicon) OST335768 (lexicon)
OST326229 (lexicon) OST316535 (lexicon) OST316511 (lexicon) OST316507 (lexicon)
OST316506 (lexicon) OST316499 (lexicon) OST255617 (lexicon) OST202513 (lexicon)
OST187482 (lexicon) OST36627 (lexicon) OST16362 (lexicon) OST7029 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010550
Sequence
ACTTCCGGTTCCCTTGCTCCGGCATGGCTGCCTTAGGGACCTGGCTGTCCA - UNI32048 - GTGTCCGGAGATTGCACTGCAGCGTAGTGGCGCGG

GCCGGTGGCCAGTGGCGACTCCA - UNI19446 - GCAAGGGCTGGCTGCCAACCCTTCCGGCTATGGGCCCCTCACGGAGCTCCCTGACTGGTCCTT

CGCGG - UNI11558 - ATGGCCGCCCTGCACCCCCAATGAAAGGCCAACTTCGAAGAAAAGCTCAAAGGGAGAAGCTTGCA - UNI17000 - AG

ACGAGTTGTACTGCTGACACAGGAAATGGATGCTGGAATACAGGCATGGAAGCTCAGGCAGCAGAAATTGCAGGAAGAAAGGAAGAAGGAACATGATCTC

AAACCTAAAGGGACTTTACTGAGAAGCCCACTTCCGAATCAATAAAAAGCAGCTCCTGCCCCACTTTCCC
Translation
MAALGTWLSS - UNI32048 - SVRRLHCSVVARAGGQWRLQ - UNI19446 - QQGLAANPSGYGPLTELPDWSFAD - UNI11558 - DGRP

APPMKGQLRRKAQREKLA - UNI17000 - RRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHDLKPKGTLLRSPLPNQ

For any suggestions or comments, please send an email to unitrap@crg.es