Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010461 (Eya4)
Chromosomal location
Chr 10: 22823974 - 23069701 (-)
Description
eyes absent 4 homolog (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1337104]
RefSeq_dna
NM_010167 
RefSeq_peptide
NP_034297.2 
UniGene
Mm.332128 
MGI
MGI:1337104 
Uniprot/SWISSPROT
Q9Z191 
Uniprot/SPTREMBL
Q8BY78 Q0VAV8 
Human Ortholog
ENSG00000112319 (EYA4)
Omim 601316 - DEAFNESS, AUTOSOMAL DOMINANT 10  605362 - CARDIOMYOPATHY, DILATED, 1J  
UniTrap UNI31590
Vector Insertion
Chr 10: 22836625 - 22843748
Public Clones IST11541H8 (tigm) IST10851A8 (tigm) IST14522F5 (tigm) IST11270E3 (tigm)
IST12426C10 (tigm) IST10509G2 (tigm) IST10419H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092665
Sequence
ACCAGAGACACAGCGCGAAGGGAAAACTTAGACACTGGAAGGAAAGCGAGTAAATACGTAGATCGGACCCGCAGATCACTGGCTGGGACAGACAATTGAA

CTTCGGGAGTCCAAGGCGGTCCGGGCCGCCAGAG ATAGTCAAGTTTGAATCCAAGGAAGCTGCTTCTGCGTGGCAGTGGCAAGAGAAGTTAGAGAACCA

CATGGAAGACACCCAGGACCTAAATGAGCAATCT GTAAAGAAAACGTGCCCAGAAGCAGATGTTTCGGAACCTCAGAATTCCAG GTCTATGGAAATGC

AAGACCTAGCAAGTCCCCATGCCTTGGTTGGAGGCAGTGATACACCTGGGAGCTCCAAGCTGGATAAATCTGGTCTCAGCAGCACTTCAGTCACAACAAA

TGGGACAGGAG TGTCTCTTCTTGCAGTCAAAACAGAGCCCTTGCACAGCAGTGAGTCCACTACCACGACTGGAGATGGAGCGCTTGACACTTTTACTGG

GTCAG TAATAACAAGCAGCGGCTACAGCCCCAGGTCGGCGCAGCAGTACTCTCCACAGCTGTACCCCTCCAA GCCCTATCCACACATTCTTTCTACAC

CAGCAGCTCAAACAATGTCGGCCTATGCAGGCCAGACTCAGTACTCTGGGATGCAGCAGCCGGCCGTCTACACAGCCTACTCGCAGACAGGACAGCCCTA

CAGCCTGCCTGCCTACG ATCTTGGTGTGATGTTGCCAGCCATCAAGACGGAAAGTGGGCTTTCCCAAACTCAGTCCCCGTTACAGAGTGGCTGCCTGAG

CTACAGCCCTGGGTTTTCTACCCCACAGCCAGGCCAGACGCCTTACTCTTACCAAATGCCAG GTTCCAGCTTTGCACCATCGTCTACTATTTATGCAAA

TAATTCCGTTTCTAATTCAACAAACTTCAGCAGCTCACAGCAG GATTACCCATCCTACACAGCCTTTGGCCAAAACCAATATGCTCAGTATTACTCAGC

ATCAACCTATGGGGCATACATGACATCAAACAACACAGCTGACGGCACATCATCGTCAACATCAACTTATCAGCTGCAGGAATCTCTCCAAGGACTGACT

AGCCAACCAG GAGAGTTTGATACAGTGCAGAGTCCCTCCACACCAATCAAAGATCTCGATGACAGAACATGTAGAAGTTCTGGGTCAAAGTCTCGAGGA

AGAGGCCGGAAAAATAATCCCTCCCCACCTCCGGACAGTGACCTAGAG CGTGTGTTTGTCTGGGACTTGGATGAAACCATCATCGTCTTCCACTCTCTC

CTCACGGGCTCTTATGCACAGAAGTATGGCAAG - UNI31591 - GATCCCCCAATGGCTGTGACTCTCGGGCTCCGGATGGAAGAAATGATCTTTAA

TCTTGCAGATACACATTTGTTTTTTAATGACTTAGAG - UNI31591 - GAGTGTGATCAAGTTCATATAGATGATGTTTCCTCCGACGACAATGGTC

AGGACTTAAG - UNI31591 - TACCTACAGTTTTGCAACTGATGGCTTCCATGCAGCTGCAAGTAGTGCGAACCTTTGTTTGCCAACAGGTGTGAGA

GGAGGAGTGGACTGGATGAGGAAGCTGGCTTTTCGTTACAGAAGAGTAAAGGAATTATATAACACCTACAAGAACAATGTTGGAG GACTCCTTGGCCCT

GCTAAGAGGGATGCATGGCTGCAGTTAAGGGCAGAGATCGAAGGCCTAACAGATTCCTGGCTAACGAATGCACTTAAGTCTTTATCAATTATTAGTACTA

G GAGTAACTGTGTAAATGTCTTGGTAACGACAACCCAGCTGATTCCTGCTCTTGCAAAAGTCCTGCTCTACAGCCTAGGAGGTGCTTTCCCCATTGAGA

ACATTTACAGCGCAACGAAAATAG GAAAAGAAAGTTGCTTTGAGCGAATAATGCAAAGGTTTGGCAGAAAAGTAGTGTATGTTGTAATTGGGGATGGTG

TAGAAGAAGAGCAGGCAGCAAAAAAG CACAACATGCCCTTTTGGAGGATATCAAGCCACTCGGACCTCTTGGCTCTACATCAAGCACTGGAATTAGAGT

ATTTGTAACTGTATTCTCTAGCTGGGGATCCATTGTTTTTATATTTCAAGTACACTGTATTTTTATGTGTGATCCAATGCCGCTGGCTTCTTCTACACAT

ATTAATGGTCTTAACGGATGAAATCATACTCGGAATGAAAACTCCAGAGTGAAGAATTCAGGTTGCTGAATGGAATTAAACTTTAGTGCTACAGAAAGGA

AGCTCTATGGTCTTATTATCTTTACAATACTTTCATGGTTTAAAACATAATAATAACAAAAATCTGTGGCAGTTGCTGACATGTATCGAGTGAGTCCTAA

CAAGAATTAACAGCTTTAGTACAGAACTCGAACCCTCCCGAGCCACAGCATCTGCTCTGCCTCTGACAAGGTGGTTGAAAACATTCCTCAAAATGGGAGC

TCTTCTCAACCCTGAGGTTTGAATCTGACTTATAGCCTACCTAGCCCAGAAAATCTGAATCGGAATGCACTCAGACTGTATAACGACAGTCCTATCTAGA

CCTATAATTTGTGTAAATTATTGATGGAAATAATTTACTGTGACTTTATTAGCAGCTGACTCTGAAAGTGGATGCAATTTTTCTTTTATTTGTCAGGGTG

GGAAAAGGGCTGGGGAAATGGGAATATAATATTGTCTCTTTTATAAGTTTGGCAAAGAGAATGTTCATACTGATGTGTTGTGCCTTAAAGACAAGACAGC

ATTTGTGTGTTACAATGTAACTTTGACTAAAGTCTCTGTAGTTAATGAAATACAAAATCAAACAAACAAAACAAACAAGCAAACAAAAACCTTTGTGATA

ATTCTTCACATGACCAAATTTAAAATTCAAGATATTAGTTTAACGTGGAAACATCAACAAACTGAATATTTGTTAAAAGGAGAAACCAGTAACAATAATA

ATACAAGAAAGCTTGCATTTTAATTGGGTTCTAAACGATTCCAGTATTCAGTATATGCCAATTATCTGAACACTCAATCATAAGCAGATTTGGGAGACTA

TGGGTTCTTTATTTAGAGAGTGAAATATATATATATTCTCAAGTGTCCTCTCTTACAGTTTTCTGGGAGGAAATTAAGAGCCATGTTCATATCAACATAC

CCAATTTTAGTTTAAGACTGGATATGTGCCAGTTGCTAAGGGGACAATATCATGGTGCACATTTAGCAAATATCATCAAAGTCATTTTTAGAACATGCTA

TGGAATGAATGTAGCTTAAAACACACATTGAGTAGGCACAGCAGATTGCATTTGTCTTTCATGCTGTTGCAAAAGCAAATATCATCAGTGATAGAAGGCA

GGTATACTAGATAGCTCTCAAGAAAAAAATCAGAATCTATGAATATTTTATATAATATCATCTTAAGTTAATTATCAAACAAGCTCTATGTTGACAACAT

CACCATATCACAACAGTAAAAGGGTATTCGCTCTCCTTGAACACACCAGCCCAGGGTCTTCCCGTTACAGACAGGAATACATTGGTTTCTTCCTGTATGG

TTGCTGAACAATTGCCTGCATTCATTCCTGGGAGAGCCTGGCTGCATTGTGTCTGCCTGTCTTTTTGTCTTGTTGGTGTATAGCCCATACTGGTAACACA

ATACAGATTCTCCTGTCGTTTCTTATGACATGGTTTGCCTTGTGGAAATTTAAGACTTCAAGAAGGAAAATATTCTAATGGTGTGAGTGCCTGAATCTCT

CTGCATTCTGAATGACATGAAATGGACCCACGAGTCCAGCTCTTAATCTCATCTGAGGCTGCTTCATAAGAGGTCATCATCTGAGGCTTTTGCAACTTAA

ATAAGGCCAACATTTTGCTCAAAGATCACAGAGAATACTCTGGAGGGATGTATTTCTTTAGAGAATGCTGTGGCCCTGTTTACAAATGGGTAGATTGAAG

ATAATTCTGCATAAGATAGGGACTCCTTATCTAAGTCCTTACTTTTTAAATGTGTCTTTTGGTTACCCTTTCCCCAATGCTATGGTGGCAAAATATGGTT

GGAATATTTTAATACTAATATCATTAATAATAAATTTTATACTCCTCT
Translation
 MEDTQDLNEQS VKKTCPEADVSEPQNSR RSMEMQDLASPHALVGGSDTPGSSKLDKSGLSSTSVTTNGTGV VSLLAVKTEPLHSSESTTTTGDGAL

DTFTGSV VITSSGYSPRSAQQYSPQLYPSK KPYPHILSTPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPAYD DLGVMLPAIKTESGLSQT

QSPLQSGCLSYSPGFSTPQPGQTPYSYQMPG GSSFAPSSTIYANNSVSNSTNFSSSQQ DYPSYTAFGQNQYAQYYSASTYGAYMTSNNTADGTSSSTS

TYQLQESLQGLTSQPG GEFDTVQSPSTPIKDLDDRTCRSSGSKSRGRGRKNNPSPPPDSDLE RVFVWDLDETIIVFHSLLTGSYAQKYGK - UNI31

591 - DPPMAVTLGLRMEEMIFNLADTHLFFNDLE - UNI31591 - ECDQVHIDDVSSDDNGQDLS - UNI31591 - STYSFATDGFHAAASS

ANLCLPTGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGG GLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTR RSNCVNVLVTTTQLIPALAK

VLLYSLGGAFPIENIYSATKIG GKESCFERIMQRFGRKVVYVVIGDGVEEEQAAKK HNMPFWRISSHSDLLALHQALELEYL
Transcript ENSMUST00000074366
Sequence
ACCAGAGACACAGCGCGAAGGGAAAACTTAGACACTGGAAGGAAAGCGAGTAAATACGTAGATCGGACCCGCAGATCACTGGCTGGGACAGACAATTGAA

CTTCGGGAGTCCAAGGCGGTCCGGGCCGCCAGAG ATAGTCAAGTTTGAATCCAAGGAAGCTGCTTCTGCGTGGCAGTGGCAAGAGAAGTTAGAGAACCA

CATGGAAGACACCCAGGACCTAAATGAGCAATCT GTAAAGAAAACGTGCCCAGAAGCAGATGTTTCGGAACCTCAGAATTCCAG GTCTATGGAAATGC

AAGACCTAGCAAGTCCCCATGCCTTGGTTGGAGGCAGTGATACACCTGGGAGCTCCAAGCTGGATAAATCTGGTCTCAGCAGCACTTCAGTCACAACAAA

TGGGACAGGAG TGTCTCTTCTTGCAGTCAAAACAGAGCCCTTGCACAGCAGTGAGTCCACTACCACGACTGGAGATGGAGCGCTTGACACTTTTACTGG

GTCAG TAATAACAAGCAGCGGCTACAGCCCCAGGTCGGCGCAGCAGTACTCTCCACAGCTGTACCCCTCCAA GCCCTATCCACACATTCTTTCTACAC

CAGCAGCTCAAACAATGTCGGCCTATGCAGGCCAGACTCAGTACTCTGGGATGCAGCAGCCGGCCGTCTACACAGCCTACTCGCAGACAGGACAGCCCTA

CAGCCTGCCTGCCTACG ATCTTGGTGTGATGTTGCCAGCCATCAAGACGGAAAGTGGGCTTTCCCAAACTCAGTCCCCGTTACAGAGTGGCTGCCTGAG

CTACAGCCCTGGGTTTTCTACCCCACAGCCAGGCCAGACGCCTTACTCTTACCAAATGCCAG GTTCCAGCTTTGCACCATCGTCTACTATTTATGCAAA

TAATTCCGTTTCTAATTCAACAAACTTCAGCAGCTCACAGCAG GATTACCCATCCTACACAGCCTTTGGCCAAAACCAATATGCTCAGTATTACTCAGC

ATCAACCTATGGGGCATACATGACATCAAACAACACAGCTGACGGCACATCATCGTCAACATCAACTTATCAGCTGCAGGAATCTCTCCAAGGACTGACT

AGCCAACCAG GAGAGTTTGATACAGTGCAGAGTCCCTCCACACCAATCAAAGATCTCGATGACAGAACATGTAGAAGTTCTGGGTCAAAGTCTCGAGGA

AGAGGCCGGAAAAATAATCCCTCCCCACCTCCGGACAGTGACCTAGAG CGTGTGTTTGTCTGGGACTTGGATGAAACCATCATCGTCTTCCACTCTCTC

CTCACGGGCTCTTATGCACAGAAGTATGGCAAG - UNI31591 - GATCCCCCAATGGCTGTGACTCTCGGGCTCCGGATGGAAGAAATGATCTTTAA

TCTTGCAGATACACATTTGTTTTTTAATGACTTAGAG - UNI31591 - GAGTGTGATCAAGTTCATATAGATGATGTTTCCTCCGACGACAATGGTC

AGGACTTAAG - UNI31591 - TACCTACAGTTTTGCAACTGATGGCTTCCATGCAGCTGCAAGTAGTGCGAACCTTTGTTTGCCAACAGGTGTGAGA

GGAGGAGTGGACTGGATGAGGAAGCTGGCTTTTCGTTACAGAAGAGTAAAGGAATTATATAACACCTACAAGAACAATGTTGGAG GACTCCTTGGCCCT

GCTAAGAGGGATGCATGGCTGCAGTTAAGGGCAGAGATCGAAGGCCTAACAGATTCCTGGCTAACGAATGCACTTAAGTCTTTATCAATTATTAGTACTA

G GAGTAACTGTGTAAATGTCTTGGTAACGACAACCCAGCTGATTCCTGCTCTTGCAAAAGTCCTGCTCTACAGCCTAGGAGGTGCTTTCCCCATTGAGA

ACATTTACAGCGCAACGAAAATAG GCAAGGAAAGCTGTTTTGAGCGTATAGTGTCCAGATTTGGCACTAACATAACTTATGTTGTGATTGGAGATGGCC

GGGATGAGGAGCACGCTGCTAACCAG CACAACATGCCCTTTTGGAGGATATCAAGCCACTCGGACCTCTTGGCTCTACATCAAGCACTGGAATTAGAGT

ATTTGTAACTGTATTCTCTAGCTGGGGATCCATTGTTTTTATATTTCAAGTACACTGTATTTTTATGTGTGATCCAATGCCGCTGGCTTCTTCTACACAT

ATTAATGGTCTTAACGGATGAAATCATACTCGGAATGAAAACTCCAGAGTGAAGAATTCAGGTTGCTGAATGGAATTAAACTTTAGTGCTACAGAAAGGA

AGCTCTATGGTCTTATTATCTTTACAATACTTTCATGGTTTAAAACATAATAATAACAAAAATCTGTGGCAGTTGCTGACATGTATCGAGTGAGTCCTAA

CAAGAATTAACAGCTTTAGTACAGAACTCGAACCCTCCCGAGCCACAGCATCTGCTCTGCCTCTGACAAGGTGGTTGAAAACATTCCTCAAAATGGGAGC

TCTTCTCAACCCTGAGGTTTGAATCTGACTTATAGCCTACCTAGCCCAGAAAATCTGAATCGGAATGCACTCAGACTGTATAACGACAGTCCTATCTAGA

CCTATAATTTGTGTAAATTATTGATGGAAATAATTTACTGTGACTTTATTAGCAGCTGACTCTGAAAGTGGATGCAATTTTTCTTTTATTTGTCAGGGTG

GGAAAAGGGCTGGGGAAATGGGAATATAATATTGTCTCTTTTATAAGTTTGGCAAAGAGAATGTTCATACTGATGTGTTGTGCCTTAAAGACAAGACAGC

ATTTGTGTGTTACAATGTAACTTTGACTAAAGTCTCTGTAGTTAATGAAATACAAAATCAAACAAACAAAACAAACAAGCAAACAAAAACCTTTGTGATA

ATTCTTCACATGACCAAATTTAAAATTCAAGATATTAGTTTAACGTGGAAACATCAACAAACTGAATATTTGTTAAAAGGAGAAACCAGTAACAATAATA

ATACAAGAAAGCTTGCATTTTAATTGGGTTCTAAACGATTCCAGTATTCAGTATATGCCAATTATCTGAACACTCAATCATAAGCAGATTTGGGAGACTA

TGGGTTCTTTATTTAGAGAGTGAAATATATATATATTCTCAAGTGTCCTCTCTTACAGTTTTCTGGGAGGAAATTAAGAGCCATGTTCATATCAACATAC

CCAATTTTAGTTTAAGACTGGATATGTGCCAGTTGCTAAGGGGACAATATCATGGTGCACATTTAGCAAATATCATCAAAGTCATTTTTAGAACATGCTA

TGGAATGAATGTAGCTTAAAACACACATTGAGTAGGCACAGCAGATTGCATTTGTCTTTCATGCTGTTGCAAAAGCAAATATCATCAGTGATAGAAGGCA

GGTATACTAGATAGCTCTCAAGAAAAAAATCAGAATCTATGAATATTTTATATAATATCATCTTAAGTTAATTATCAAACAAGCTCTATGTTGACAACAT

CACCATATCACAACAGTAAAAGGGTATTCGCTCTCCTTGAACACACCAGCCCAGGGTCTTCCCGTTACAGACAGGAATACATTGGTTTCTTCCTGTATGG

TTGCTGAACAATTGCCTGCATTCATTCCTGGGAGAGCCTGGCTGCATTGTGTCTGCCTGTCTTTTTGTCTTGTTGGTGTATAGCCCATACTGGTAACACA

ATACAGATTCTCCTGTCGTTTCTTATGACATGGTTTGCCTTGTGGAAATTTAAGACTTCAAGAAGGAAAATATTCTAATGGTGTGAGTGCCTGAATCTCT

CTGCATTCTGAATGACATGAAATGGACCCACGAGTCCAGCTCTTAATCTCATCTGAGGCTGCTTCATAAGAGGTCATCATCTGAGGCTTTTGCAACTTAA

ATAAGGCCAACATTTTGCTCAAAGATCACAGAGAATACTCTGGAGGGATGTATTTCTTTAGAGAATGCTGTGGCCCTGTTTACAAATGGGTAGATTGAAG

ATAATTCTGCATAAGATAGGGACTCCTTATCTAAGTCCTTACTTTTTAAATGTGTCTTTTGGTTACCCTTTCCCCAATGCTATGGTGGCAAAATATGGTT

GGAATATTTTAATACTAATATCATTAATAATAAATTTTATACTCCTCT
Translation
 MEDTQDLNEQS VKKTCPEADVSEPQNSR RSMEMQDLASPHALVGGSDTPGSSKLDKSGLSSTSVTTNGTGV VSLLAVKTEPLHSSESTTTTGDGAL

DTFTGSV VITSSGYSPRSAQQYSPQLYPSK KPYPHILSTPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPAYD DLGVMLPAIKTESGLSQT

QSPLQSGCLSYSPGFSTPQPGQTPYSYQMPG GSSFAPSSTIYANNSVSNSTNFSSSQQ DYPSYTAFGQNQYAQYYSASTYGAYMTSNNTADGTSSSTS

TYQLQESLQGLTSQPG GEFDTVQSPSTPIKDLDDRTCRSSGSKSRGRGRKNNPSPPPDSDLE RVFVWDLDETIIVFHSLLTGSYAQKYGK - UNI31

591 - DPPMAVTLGLRMEEMIFNLADTHLFFNDLE - UNI31591 - ECDQVHIDDVSSDDNGQDLS - UNI31591 - STYSFATDGFHAAASS

ANLCLPTGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGG GLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTR RSNCVNVLVTTTQLIPALAK

VLLYSLGGAFPIENIYSATKIG GKESCFERIVSRFGTNITYVVIGDGRDEEHAANQ HNMPFWRISSHSDLLALHQALELEYL

For any suggestions or comments, please send an email to unitrap@crg.es