Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010607 (Pigyl)
Chromosomal location
Chr 9: 21961310 - 21962776 (+)
Description
phosphatidylinositol glycan anchor biosynthesis, class Y-like Gene [Source:MGI Symbol;Acc:MGI:1913518]
Human Ortholog
not available
Omim not available
UniTrap UNI36831
Vector Insertion
Chr 9: 21961358 - 21962175
Public Clones IST13209F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010751
Sequence
GTCACCGCCAGGCGCCGAAGGGACCGGACTCCTACAGGCCTGCAAACG - UNI36831 - TTAAAAGACCTCTCGCCTGCGCTGCGAGGGACACAGGT

GGTGTCTGCAGTCGCTGGTAACCGCTGCGTGTGACGCGGAGGCTGAGGAGCCGGCACCTTCGGCCTGGGACCCCTGGACTTTCTGCGTGCCCTTGGGAAG

CATGCCTGGGTGAATGAGGAGTCGGGACAAGGGGAAGATAAGACAAGAGCGCACCCGCACGAGAACAGAACTTTTCAAACAACTGAGTTTTCTTGAGACA

GTTAACCTTTTAAGAAGGGAGGAAGATGATCCGGTCCCTGCCCACCATGACCGTCCTCATCCCACTGGTCTCGCTGGCAGGCCTGCTCTACTCCGCCTCC

GTGGAGGAAGGCTTCCCAGAGGGCTGCACCAGCGCCAGCAGCCTGTGCTTCTACAGCTTGCTCTTGCCGGTCACCGTGCCTGTGTACGTGTTCTTCCATC

TGTGGACATGGATGGGCCTGAAGCTCTTCAGACATAACTAGGGGAGCCGAGGCCCCTCCTGCTCGGGCTGCCTGCGGAGTGGGGCATGGCCGGAGGTTCC

TGGCTGTTGCAGATTCTTTTGTAGCTGAAAAATACTTTTCAATAAAATGTCTTATGGGAGAGG
Translation
 - UNI36831 - MRSRDKGKIRQERTRTRTELFKQLSFLETVNLLRREEDDPVPAHHDRPHPTGLAGRPALLRLRGGRLPRGLHQRQQPVLLQLALAG

HRACVRVLPSVDMDGPEALQT

For any suggestions or comments, please send an email to unitrap@crg.es