Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010660 (Plcd1)
Chromosomal location
Chr 9: 118980648 - 119002620 (-)
Description
phospholipase C, delta 1 Gene [Source:MGI Symbol;Acc:MGI:97614]
RefSeq_dna
NM_019676 
RefSeq_peptide
NP_062650.1 
MGI
MGI:97614 
Uniprot/SWISSPROT
Q8R3B1 
Uniprot/SPTREMBL
Q05DG3 Q9Z1B4 
Human Ortholog
ENSG00000187091 (PLCD1)
Omim not available
UniTrap UNI31102
Vector Insertion
Chr 9: 118993707 - 119002621
Public Clones IST14717F3 (tigm) IST10524C12 (tigm) IST14854D2 (tigm) IST14854D3 (tigm)
IST14963D8 (tigm) IST14395A1 (tigm) IST13828D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18575
Vector Insertion
Chr 9: 118990269 - 118993707
Public Clones (ggtc) CMHD-GT_259A11-3 (cmhd) IST14424F1 (tigm) IST12357C9 (tigm)
IST12853H3 (tigm) IST11519A4 (tigm) IST13508H4 (tigm) IST12546H3 (tigm)
Private Clones OST420397 (lexicon) OST188360 (lexicon) OST74853 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31961
Vector Insertion
Chr 9: 118985201 - 118990269
Public Clones IST14856E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010804
Sequence
ATCTCAGTTCAGTTGGGTCCCTGCACCGGACTGCGCAAGGACCCCAGGCCGCTTGGTGATTTTGCTCAAGTGAATCACGCCGCGTCCCCTCCTCCGCGCG

CCCCGACCGGCATGGACTCCGGTCGGGACTTCCTGACCTTGCACG - UNI31102 - GGCTGCAGGATGACCCGGACCTTCAGGCCCTCCTGAAGGGC

AGCCAGCTTCTGAAGGTGAAGTCCAGCTCGTGGCGTAGAGAACGCTTCTACAAGCTACAGGAGGACTGCAAGACCATCTGGCAGGAATCTCGCAAGGTCA

TGAGGTCCCCGGAGTCGCAGCTGT - UNI18575 - - UNI31102 - - UNI31961 - TCTCCATCGAGGACATTCAGGAGGTGCGGATGGGAC

ACCGCACAGAAGGCCTGGAGAAATTTGCCAGAGACATACCCGAGGACCGATGCTTCTCCATCGTCTTCAAGGACCAGCGCAATACCCTAGACCTCATCGC

CCCGTCTCCAGCTGACGTCCAGCATTGGGTGCAGGGCCTGCGCAAGATCATCGACCGCTCGGGCTCCATGGACCAGCGGCAGAAGCTGCAGCA - UNI3

1961 - CTGGATTCACTCCTGCTTGCGAAAGGCTGATAAAAACAAGGATAACAAGATGAACTTCAAGGAGGTGAAGGACTTCCTGAAGGAGCTCAACGT

ACAGGTGGATGACAGCTACGCCAGGAAGATCTTCAGG - UNI31961 - GAATGTGACCACTCCCAGACAGACTCGCTGGAGGATGAGGAGATTGAGA

CCTTCTACAGGATGCTGACCCAGCGGGCAGAGATCGACCGTGCCTTTGCAGAGGCCGCAGGTTCTGCGGAGACCCTGTCGGTGGAGAAGCTAGTGACGTT

CCTGCAGCATCAGCAGCGGGAGGAGGAGGCGGGGCCAGCCTTGGCCCTCTCTCTCATTGAGCGCTACGAGCCCAGTGAGACTG CCAAAGCCCAGCGGCA

GATGACCAAGGATGGCTTCCTCATGTACCTGCTGTCTGCTGACGGTAACGCCTTCAGCCTGGCGCACCGCCGTGTCTACCAGGACATGAACCAGCCGCTC

AGCCACTACTTAGTGTCTTCTTCCCACAACACCTACCTACTGGAGGACCAGCTCACAGGGCCCAGCAGCACGGAGGCCTACATCCG GGCTCTGTGCAAA

GGCTGCCGGTGTCTGGAGCTGGACTGCTGGGACGGCCCCAACCAGGAACCCATCATCTACCATGGCTACACTTTTACCTCTAAGATACTTTTCTGCGACG

TGCTCAGGGCCATCCGGGACTACGCCTTCAAG GCATCCCCCTACCCAGTTATCCTGTCCCTGGAGAACCACTGCAGCCTGGAGCAACAACGAGTCATGG

CTCATCACCTGAGGGCCATCCTGGGGCCCATGCTGTTGGACCAGCCGCTGGATGGGGTTACCACGAGCCTGCCTTCGCCTGAG CAACTGAAGGAAAAGA

TTCTGTTGAAAGGGAAGAAACTGGGCGGGCTGCTACCTGCTGGAGGGGAAAACGGGCCTGAAGCCACCGATGTGTCTGACGAAGATGAGGCTGCTGAAAT

GGAAGATGAGGCCGTGCGCAGCCAAGTGCAACACAAGCCCAAG GAGGATAAGCTAAAGCTGGTGCCGGAGCTCTCCGACATGGTCATTTACTGCAAGAG

TGTCCACTTTGGTGGCTTCTCCAGTCCTAGCACCTCTGGGCAGGCATTCTATGAGATGGCTTCCTTCTCCGAGAGCCGTGCCCTGCGGCTGCTGCAAGAA

TCAG GAAATAGTTTTGTCCGCCATAACGTGGGCCATCTGAGCAGGATCTACCCAGCTGGGTGGAGGACAGATTCCTCCAACTACAGTCCCGTGGAGATG

TGGAATGGAGGCTGCCAGATTG TGGCTCTGAACTTCCAAACCCCTGGGCCAGAAATGGATGTTTACCTTGGCTGCTTCCAGGACAATGGAGGTTGTGGG

TATGTGCTGAAACCGGCCTTCCTGAGAGACCCTGACACCACCTTCAACTCACGGGCCCTGACTCAGGGGCCCTGGTGGGCCCCGAAGAAGCTCCGAGTCT

GG ATCATCTCTGGACAGCAGCTGCCGAAGGTCAATAAGAATAAGAATTCTATCGTGGACCCCAAGGTGATAGTGGAGATCCACGGTGTGGGCCAGGATG

TGGCCAGCCGTCAGACAGCAGTTATTACCAATAATG GTTTCAACCCACGGTGGGACACGGAGTTTGAGTTTGTGGTAGCAGTGCCTGACCTTGCCCTTG

TACGTTTCATGGTAGAGGATTATGACTCCTCCTCTAAGAACGACTTTATCGGCCAGAGTACTATCCCCTGGAACAGCCTCAAGCAGG GGTACCGCCATG

TCCACCTCTTGTCTAAGAATGGAGACCTGCATCCATCAGCCACTCTCTTTGTGAAGATCTCCATCCAGGACTAAGCCTGGGGGACTGACGCAGTCCGCCC

TGAGTGGGCGGAGCTGTGTCCACACCTGTCTGGCAATGTTGCACCTCTGGCGCGGAGCTTGAGGCCACTGAACTGCCTTCAGCTCTAACACATCGCCTGA

GCTTCTACTTCTCTGGGGGTCCAGGAGCAGTCCAGTCCCCGGAGTGGTCTAAAATTCCGTTAGGAACAACACTGCATCTCTCTCCCTACCCCTAGTTGAC

TTTAGGTTGTGAGTTTTTATATAAAAAAAAATAATAATCACAAGAT
Translation
MDSGRDFLTLHG - UNI31102 - GLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRSPESQLF - UNI18575 - - UN

I31102 - - UNI31961 - FSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADVQHWVQGLRKIIDRSGSMDQRQKLQH 

- UNI31961 - HWIHSCLRKADKNKDNKMNFKEVKDFLKELNVQVDDSYARKIFR - UNI31961 - ECDHSQTDSLEDEEIETFYRMLTQRAEID

RAFAEAAGSAETLSVEKLVTFLQHQQREEEAGPALALSLIERYEPSETA AKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMNQPLSHYLVSSSHNT

YLLEDQLTGPSSTEAYIR RALCKGCRCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFK ASPYPVILSLENHCSLEQQRVMAHHLRAILG

PMLLDQPLDGVTTSLPSPE QLKEKILLKGKKLGGLLPAGGENGPEATDVSDEDEAAEMEDEAVRSQVQHKPK EDKLKLVPELSDMVIYCKSVHFGGFS

SPSTSGQAFYEMASFSESRALRLLQESG GNSFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIV VALNFQTPGPEMDVYLGCFQDNGGCGYVLK

PAFLRDPDTTFNSRALTQGPWWAPKKLRVW IISGQQLPKVNKNKNSIVDPKVIVEIHGVGQDVASRQTAVITNNG GFNPRWDTEFEFVVAVPDLALVR

FMVEDYDSSSKNDFIGQSTIPWNSLKQG GYRHVHLLSKNGDLHPSATLFVKISIQD

For any suggestions or comments, please send an email to unitrap@crg.es