Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010721 (Lmbr1)
Chromosomal location
Chr 5: 29556354 - 29704930 (-)
Description
limb region 1 Gene [Source:MGI Symbol;Acc:MGI:1861746]
RefSeq_dna
NM_020295 
RefSeq_peptide
NP_064691.2 
MGI
MGI:1861746 
Uniprot/SWISSPROT
Q9JIT0 
Human Ortholog
ENSG00000105983 (LMBR1)
Omim 174500 - POLYDACTYLY, PREAXIAL II  186200 - SYNDACTYLY, TYPE IV  200500 - ACHEIROPODY  
UniTrap UNI489
Vector Insertion
Chr 5: 29691747 - 29704666
Public Clones CJ0507 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25489
Vector Insertion
Chr 5: 29673447 - 29687587
Public Clones (sanger)
Private Clones OST181631 (lexicon) OST179564 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23413
Vector Insertion
Chr 5: 29619490 - 29650341
Public Clones not available
Private Clones OST260761 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088188
Sequence
TGGCGTTTCTGTCCGGCCACGAGAGACTGTATAGCCCCGCCGCCCGCGGGCAATGGTGCGGCGGAGCGCGCAGACGCGGGCGGCCCTGCGGTGGGTATGA

AAGGAGGATGGAAGGGCAGGACGAGGTGTCGGCGCGGGAGCAGCACTTCCACAGCCAAGTGCGAGAGTCCACG - UNI489 - AGAAATGGAAGATTC

ACCTCGTATCTGTGGTAA
Translation
MEGQDEVSAREQHFHSQVREST - UNI489 - RNGRFTSYLW
Transcript ENSMUST00000055195
Sequence
CGCCCAGGCTGTGGCCATTCCCCGCCTCTTGTATCTTGAACCGCTTCTCCCTGAGCTCAGGCGGCGTTTTCCGATCCTGCTGCGGTCTAGGTGGCGTTTC

TGTCCGGCCACGAGAGACTGTATAGCCCCGCCGCCCGCGGGCAATGGTGCGGCGGAGCGCGCAGACGCGGGCGGCCCTGCGGTGGGTATGAAAGGAGGAT

GGAAGGGCAGGACGAGGTGTCGGCGCGGGAGCAGCACTTCCACAGCCAAGTGCGAGAGTCCACG - UNI489 - ATATGTTTTCTTCTCTTTGCCATT

CTCTACATCGTTTCCTACTTCATCATTATAAGATACAAGAGAAAATCCG ATGAACAAGAAGATGAGGATGCTGTAGTCAACAGGATATC - UNI2548

9 - GTTGTTTCTGAGCACCTTCACTCTAGCCGTGTCAGCTGGCGCGGTTTTGCTTTTACCCTTCTCAATCATCAGCAATGAGATCCTGCTTGCTTTTCC

TCACAACTACTATATTCAGTGGCTGAATGGCTCCCTCATCCACG GTTTGTGGAATCTTGCTTCTTTATTTTCCAATCTTTGTTTATTTGTGTTGATGCC

CTTTGCCTTTTTCTTTCTGGAATCAGAAGGTTTTGCAGGCCTGAAAAAG - UNI23413 - GGAATCCGAGCCCGCATTTTGGAAACTCTGGTTATGC

TGCTGCTTCTTGCGTTGCTGATTCTTGGGATGGTGTGGGTGGCTTCCGCCCTGATTGACAGTGATGCTGCCAGTATGGAGTCTTTATATG ATCTCTGGG

AATTCTACTTGCCCTATTTGTATTCTTGCATTTCGCTGATGGGATGCTTGCTGCTTCTCT TGTGTACTCCAGTTGGCCTGTCCCGTATGTTCACAGTCA

TGGGTCAGTTGCTGGTGAAGCCAGCG ATTCTTGAAGACCTGGATGAACAAATTTATATGATTACTCTAGAAGAAGAAGCACTCCAGAGAAGACTACATG

 GGCTATCTTCATCGGTGGAGTACAATGTAATGGAATTGGAGCAAGAACTTGAGAATGTAAAGATCCTTAAGACAAAATTAG AGAGGAGGAAAAAGGCT

TCAGCTTGGGAGAGAAATTTGGTGTATCCTGCTGTTATGGTTCTCCTTCTTATTGAAACA TCCATTTCAGTCCTCCTGGTGGCGTGCAATATTCTTTGC

CTGCTGGTTGATGAGACTGCAATGCCAAAGGGAACAAGG GGCCCCGGCATAGGAAGTGCCTCTCTTTCCACTTTTGGCTTTGTGGGAGCTGCACTTGAA

ATCATTCTGATTTT CTATCTCATGGTGTCTTCTGTTGTTGGTTTCTATAGCCTCAGATTTTTTGGAAACTTTACACCCAAGAAGGATGACACAACTATG

ACAAAG ATCATTGGGAATTGTGTGTCAATCTTAGTCTTGAGCTCTGCTTTGCCTGTGATGTCCAGAACACTGG GAATCACTAGATTCGATCTACTTGG

AGACTTTGGAAGATTTAATTGGCTGGGAAATTTCTATATTGTATTATCCTACAATTTACTCTTCGCCATCATGACAACATTGTGTTTGATCAGAAAATTC

ACATCAGCAGTACGAGAAGAACTTTTCAAGGCCCTAG GACTTCACAAACTTCACTTGTCAGATACCTCAAGGGATTCAGAAACTACAAAGCCTTCTGCA

AATGGGCATCAGAAAGCACTGTGAGACCTGACTGCCTCAGTAGCACTCTACAGCAAGTCCCGACAACTGATTCATGACATTCCCATAGACAGTGTTCATT

CTGGTGGGTCTGGACCCAGCTGACAGTGCCCTTTCGCATAAGCACTTACAACTTAGCACTAGTCATCTGTGTCTCCTGGGAGTTTTCTGATTGGCCGGAT

ATGACAGCTTTTGGTTAAACCCTGAGTCTTGAGACTGAGGAAAAGCTGTGTGTCTATAGCAGGAACTACCTGGATGAGAGGTGAAGACTCGGACGCCCTT

AGGCTTTTGCTTTACACCATGAGAAGCTTGGTTCTGCAGGCAGAAGCCTGCCTGAAAGTCATCTGGTGCCCCAAAGCATTTTCACAAGGTCCTGGAAACT

GTTGTACAAGTAACAAACTACATTTTTATTTAAAAAACCAAAAGCAGATTTTCTGATTCATCTTACAGAATCTTCATTAGACTTTGAGCCAGTGGAACAT

ACTAGATTCTTTAAACACCTGAGCCTTGGTGGGCAGCCCCAGGACTATTTTTTTGTGGTAAGCTGCAGTATGAAGCACATGCGATTGTAGATTTGGACAG

TGTGTGTACCTGATAATACTTTTCACAGCACAGTGCCAGTGTTGTACACACCTTAGACTTTGCCTTATAGGCTGTATGTACATTCATTTTTTAAAACCTT

TTTTTCAAAAACTACTCCACTCTGTGCTTGTTGTATGTGTGTAACCCAAAGACAGAAATTGCTTTTTCAGGCTTCGGTGCCTCTCATACACCACCTTAAG

TCTCCACCCCAGGAAGGTTACCAGTGTGATACCCAGAACTTACAGGTCAGGGTCTCCACAGAAGGGCAGGTGCAGCAGGTGCAGCTCATAACTAATATGA

GCTCATAACTACTTAGTTGTTTAGTTTAATTGTTGGAATGGTTTCTCAACTCCTGAGTCTACTGATTTAAAAAAAAAAAAAAAAACTGAGCGCATGCTAT

TGTTGTTCCTAGGTAGCACACATTTCACAGAAATATAGTGATGCTCACATGCACTGTATGGATGACATAACAGGATTTGTGTTCAGAAAAAGAAGTAAAG

CACTTTTTTCTCAAATTGTTGAATTTAGTTTCTTTTGGAGACATATATGAAAGGCTGTATCTGACCTTTATTTAATCTTAGAAAACCAAGAAGATTTAGC

TCTATGTTTATAAGCCATTGAGTCCACATCTTTATTTACACCATGGCATCCCCTGATACTCCAGGTTAGTTTTAAGGAAACTTGGTGCTGTGGCTCTGAG

TGGGTCAGTGTGTACCTCCAGTGAGTATTGATAGATTCCCGAGTGTGAGCTCCTGCGCTAGCACAGTGCGAGTTGGCTATTTCCGATTTACCTGGTCATT

AATGACAGGCTCTGAAGCAGAGCAAGTCAGGGAGAGGTCAGAGTTTTCTGCTGCAGTCACTTCGGTGCACACCATTTGCCAACAACCAAACAGAGCTCTG

CAAGGTAAGGTGTCTGAAAATTTTCATAAAATACTGAACTTTTCAATGTCTGTCTCTAATTTTCTTAATGAGTGTCTATATGTGAGGGGGGAGGGAGGGA

AAGAGAGACAGACGGGCAGATAGACAGAAACATGGGGGCAGGCATTAATGAGTAAAGATCTAAAGGACAGCTTTCAGTAGTCAGCTCTTTCCTTTCACAT

GTGTGATTCAGGTACCTTTACCTGCTGAGCAAGTCCTAAACTTCTTATTCATTTGGAGGTTCTTAATTTGAAGATGGGATCCAGGTTTGGACTGACTGGA

GATATTTGGTGATGAGATGGAAGTGGGCTTTAAGGATTGTCTTACCTTGATTCTTGGGCCTTCTGTGGTTGATGCACTGCGTGGTCACCACCCTTTGAGG

GTCACTGGTCACTCACCTGAGAGTTGCCTGGAGGGAGGGACTGGTTCCAGGTGCCATCACTTCACTGGGCATGTGCTAGAGGCTGGCTGATACAGAACTT

CACGAAAGGACAGCAGCATGCTGAGGCTTCATATTCCAAGTTCGTGAAGACAGTTATATGCAGGAGTCCTGCATTGCAGTGCTGTTTTACAGAGTGCAGA

AAGCTCTGCAGACAAGAGCTCCCATTCACACTAGTCATGGCACTCTAGTTTTGACTAGATGAGGTTGCACCAGTGACTCTGTTGAGTAGTCCTTTTGTTC

TCTTACCTTGAATGTCCTCTTTAAACGGGCATGAAACTGGGCATGGTAGTGTTTTCCTTATAGCACTCAAGTGGCAGAGGCAGAAGGATCCCTAAGAATT

TGAACCAGACTAGGTTACATAGTGAGTTCCAGGCAAGCCAGTGCTACATAGTGAAACTGTCTCTCAAAAGAAACAAACATACAAACGAAAGCAAAAAGAG

GAAATGAGGGTTGGAGGTGGAATGGCTGGAGAGATGGCTCAGCAGTTAAAGAGCACTAGCTTTGCTTTCAGAGGACTCAGATTTGGTTCTTAGCATCCAC

ATGGTGGTTCACAGTCATCAGTGACTCTAGTCCCAGGGGATTAAATACCCTTTCAGACCTCCATGGGCACTGACTGCAGGCACATGGTGAAGGAAAAACA

CTTCCATACATAAAAATAATTACTACAATTTAAGCTAAAAGGGCACCAAACACTTTATAGATCTTGATGAGAGGCTATATCAAATTTTATACATTGTGAC

ACCGGTTTTTTATAGATTTTCTAGCATATATTTTAGATCTATTTATCATCTATCTATCTATCTATCTATCTATCTTTCTATCATCTATCTTATATAAAAT

AAAGTCTGACCTAAATATGAGACCCTGTATGGTTGTCTAAAAACATACTGTTAGCTCCTTCAGTCACACCTGTTTGGGGCTGGCTGGTGAATCAGAAGGA

ACCTTGTTGGGTCTGCTGCTCACCACCTATGGGGCTGTGGGCATGGTGGCAGCAGCAGTTGTTGCCACTTCTGCTTTGGCCAAGCACAGTAGGTGATCCT

GATAGTCAGCAGCACAGATTCCCATTGATTCTAGTCTATGTATTTGCTTATGGTTGGTACAATATTTAATGTATATAGGCAGAAGTATTATAGGGTCTTT

AAATATGTGAACATATGTAGCACTGCTTTTAAACTTAAAACGGATATGATATTTTTCATATGTCAAGACACACTGGTAAATTTCTGTTACATATTGTTTT

CAAGTTTTCTGTTAGTCTTGTTTCTATGAGGTACTTTTATTGTAACTTAAAATTCTTAGAAATTAAAGTTCTG
Translation
MEGQDEVSAREQHFHSQVREST - UNI489 - ICFLLFAILYIVSYFIIIRYKRKSD DEQEDEDAVVNRIS - UNI25489 - SLFLSTFTLAVS

AGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHG GLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKK - UNI23413 - GIRARILETLVMLL

LLALLILGMVWVASALIDSDAASMESLYD DLWEFYLPYLYSCISLMGCLLLLL LCTPVGLSRMFTVMGQLLVKPA ILEDLDEQIYMITLEEEALQRR

LHG GLSSSVEYNVMELEQELENVKILKTKLE ERRKKASAWERNLVYPAVMVLLLIET SISVLLVACNILCLLVDETAMPKGTR GPGIGSASLSTFG

FVGAALEIILIF FYLMVSSVVGFYSLRFFGNFTPKKDDTTMTK IIGNCVSILVLSSALPVMSRTLG GITRFDLLGDFGRFNWLGNFYIVLSYNLLFA

IMTTLCLIRKFTSAVREELFKALG GLHKLHLSDTSRDSETTKPSANGHQKAL

For any suggestions or comments, please send an email to unitrap@crg.es