Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010755 (Cars)
Chromosomal location
Chr 7: 150743611 - 150785961 (-)
Description
cysteinyl-tRNA synthetase Gene [Source:MGI (curated);Acc:Cars-002]
RefSeq_dna
NM_013742 
RefSeq_peptide
NP_038770.3 
UniGene
Mm.125659 
MGI
MGI:1351477 
Uniprot/SWISSPROT
Q9ER72 
Uniprot/SPTREMBL
Q3UXN3 Q7TNP6 Q3U716 
Human Ortholog
ENSG00000110619 (CARS)
Omim not available
UniTrap UNI154
Vector Insertion
Chr 7: 150778566 - 150785886
Public Clones GC0138 (tigem) (sanger) CSI090 (baygenomics) CSI209 (baygenomics) RRT603 (baygenomics)
PST14347-NR (escells) PST7941-NR (escells) IST10024F9 (tigm)
Private Clones OST426607 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14894
Vector Insertion
Chr 7: 150774396 - 150778566
Public Clones (ggtc) D135A09 (ggtc) PST4651-NR (escells) PST9185-NR (escells) PST4651-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35991
Vector Insertion
Chr 7: 150773009 - 150774489
Public Clones (sanger) IST12192D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19595
Vector Insertion
Chr 7: 150743912 - 150745032
Public Clones not available
Private Clones OST388237 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010899
Sequence
AGATTCTGGAAGGCGTCTGTGGCGGCGGCCGCGGGTCTTGATTCCCAGTGATGGCAGGTTCCTCCGCGGAGCAGG - UNI154 - - UNI14894 - 

CTGCCGACTACAGGTCCATTCTGAGCATTAGTGACGAGGCAGCCAGGGTGCAGGCCCTGGACCAACACCTCAGCACGCGTAGCTATATCCAGGGGTACTC

CCTATCCCAGGCAGATGTGGACGTGTTCAGGCAGCTCTCGGCCCCTCCCGCTGACTCAAGGCTCTTCCACGTGGCTCGGTGGTTCAGGCACATAGAAGCG

CTCCTGGGTGGCCCCCAAGGCAGAGACGAGCCCTGCAGGCTTCAAGCAA - UNI14894 - GTAAAGGCCGGCGAGTGCAGCCTCAGTGGTCCCCCCC

AGCAGGGACTGAGCCCTGCAGGCTCCGCCTCTATAATAGCCTCACCCGGAACAAG - UNI14894 - GATGTATTTATACCTCAAGATGGGAAGAAGG

TGACGTGGTACTGTTGCGGGCCGACTGTCTATGATGCGTCTCACATGGGACATGCCAG GTCCTACATCTCCTTCGATATCCTGAGGAGGGTGCTGAGGG

ATTACTTCCAGTATGATGTCTTTTACTGCATGAACATCACAGACATTGATGATAAG ATCATCAGGCGGGCACGGCAGAACTACCTGTTTGAGCAGTATC

GGGAGCAGAAACCCCCAGCCACCCAGCTCCTGAAGGATGTCCGTGATGCCATGAAG CCATTTTCAGTCAAGTTAAGTGAGACAACAGATCCCGACAAGA

GGCAGATGCTGGAGCGGATCCAGAACTCTGTGAAACTTGCCACAGAACCACTGGAACAGGCTGTGCGATCCAGCCTCTCTGGAGAGGAAGTAGACAGCAA

AGTACAG GTGTTGCTGGAGGAAGCAAAGGACTTGCTCTCTGACTGGCTGGATTCCACAGGTGGCAGTGAGGTGACTGACAACTCGATTTTCTCCAAACT

GCCCAAGTTCTGGGAAGAAGAGTTCCACAAAGACATGGAAGCCCTGAAT GTTCTCCCTCCTGATGTCCTAACCCGTGTCAGTGAATATGTGCCAGAAAT

TGTGAACTTCGTCCAGAAGATTGTGGACAATGGTTATGG TTATGCTTCAAATGGATCTGTTTACTTCGACACAGCCAAGTTTGCTGCTAGTGAAAAGCA

CTCCTATGGGAAGCTGGTGCCTGAGGCCGTTGGGGATCAGAAGGCACTTCAGGAAGGGGAAG GTGATCTGAGCATCTCTGCTGACCGCCTTAGTGAGAA

ACGCTCTCCCAATGACTTTGCCTTGTGGAAGGCCTCCAAGCCAGGCGAGCCATCCTGGCCTTGCCCCTGGGGAAAG GGTCGTCCCGGATGGCACATAGA

GTGTTCTGCTATGGCAGGCACGCTCCTGGGAGCCTCAATGGACATTCATGGTGGAGGGTTTGACCTCCGCTTCCCCCACCATGACAATGAGCTGGCACAG

TCGGAG GCCTACTTTGAAAATGACTGCTGGGTCAGGTACTTCTTGCACACGGGCCACTTGACGATAGCAGGCTGCAAGATGTCCAAGTCACTGAAAAAC

TTTATCACCATTAAAGATGCCTTGAAGAAGCACTCAG CACGGCAGCTGCGACTGGCATTCCTCATGCACTCATGGAAAGACACACTGGACTATTCCAGC

AACACTATGGAGTCTGCTCTTCAGTATGAAAAATTCATGAAC GAGTTTTTCTTAAATGTGAAAGACATCCTCCGAGCCCCTGTAGACATCACTGGCCAG

TTTGAAAAGTGGGAAGCTGAAGAAGTGGAGCTAAATAAGAA CTTCTATGGCAAGAAGACCGCAGTTCACGAAGCCTTGTGTGATAACATTGACACCCGG

ACTGTCATGGAAGAGATGCGGGCTTTGGTCAGTCAGTGCAACCTCTACATGGCAGCCAGGAAGGCTGAACGGAGGAGGCCCAACCGGGCTCTGCTGGAGA

ACATTGCCATGTACCTCACCCACATGCTGAAG ATCTTTGGGGCCATAGAGGAGGAGAGCCCCCTGGGGTTCCCAGTTGGTGGGCCTGGAACCAACCTGA

AC CTCGAGTCAACAGTCATGCCCTACCTTCAGGTGTTATCAGAATTCAGAGAGGGAGTACGAAAGATTGCCCGAGAGAAAAAAG TTCTTGAGGTTCTA

CAGCTCAGTGATGCCCTCCGGGATGACATCCTGCCTGAGCTTGGGGTCCGGTTTGAAGACCATGAAG GGCTGCCAACAGTGGTGAAGTTGGTGGACAGA

GACACCTTACTGAAAGAGAAGGAAGGAAAGAAAAGG GCTGAAGAAGAGAAGAGGAGGAAGAAAGAGGAGGCGGCCAGAAAGAAACAGGAGCAAGAA GC

AGCAAAGCTGGCCAAGATGAAGATACCACCCAGTGAGATGTTCCTGTCAGAAGTCAACAAGTATTCTAAATTTGATGAAAAT - UNI19595 - GGTC

TGCCTACCCACGACACCGAAGGCAAAGAGCTGAGCAAGGGCCAGGCCAAGAAGCTGAAGAAGCTCTTTGAAGCCCAGGAGAAACTGTACAAGGAGTATCT

GCAAATGTTACAGAATGGCAGCCTCCAGTGATGCCACGGCAGCCCAGGAGGGGCGCACCTGCCAGCCTGGCTGCTATGGACTAGGCCACAGCTACTGAGG

CTCCGTGCCCTGATCATGTTTACAGCTGTTCTCACACCTGAATCAGGCAGAGTGGTAGCAGCTCTGGGACACTGATAATAAATTCTTCTGAACGGTG
Translation
MAGSSAEQA - UNI154 - - UNI14894 - AADYRSILSISDEAARVQALDQHLSTRSYIQGYSLSQADVDVFRQLSAPPADSRLFHVARWFRHIE

ALLGGPQGRDEPCRLQAS - UNI14894 - SKGRRVQPQWSPPAGTEPCRLRLYNSLTRNK - UNI14894 - DVFIPQDGKKVTWYCCGPTVYDA

SHMGHAR RSYISFDILRRVLRDYFQYDVFYCMNITDIDDK IIRRARQNYLFEQYREQKPPATQLLKDVRDAMK PFSVKLSETTDPDKRQMLERIQNS

VKLATEPLEQAVRSSLSGEEVDSKVQ VLLEEAKDLLSDWLDSTGGSEVTDNSIFSKLPKFWEEEFHKDMEALN VLPPDVLTRVSEYVPEIVNFVQKIV

DNGYG GYASNGSVYFDTAKFAASEKHSYGKLVPEAVGDQKALQEGEG GDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGK GRPGWHIECSAM

AGTLLGASMDIHGGGFDLRFPHHDNELAQSE AYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALKKHSA ARQLRLAFLMHSWKDTLDYSSNT

MESALQYEKFMN EFFLNVKDILRAPVDITGQFEKWEAEEVELNKN NFYGKKTAVHEALCDNIDTRTVMEEMRALVSQCNLYMAARKAERRRPNRALLE

NIAMYLTHMLK IFGAIEEESPLGFPVGGPGTNLN LESTVMPYLQVLSEFREGVRKIAREKKV VLEVLQLSDALRDDILPELGVRFEDHEG GLPTVV

KLVDRDTLLKEKEGKKR AEEEKRRKKEEAARKKQEQE AAKLAKMKIPPSEMFLSEVNKYSKFDEN - UNI19595 - GLPTHDTEGKELSKGQAKK

LKKLFEAQEKLYKEYLQMLQNGSLQ
Transcript ENSMUST00000105909
Sequence
AGATTCTGGAAGGCGTCTGTGGCGGCGGCCGCGGGTCTTGATTCCCAGTGATGGCAGGTTCCTCCGCGGAGCAGG - UNI154 - - UNI14894 - 

GTAAAGGCCGGCGAGTGCAGCCTCAGTGGTCCCCCCCAGCAGGGACTGAGCCCTGCAGGCTCCGCCTCTATAATAGCCTCACCCGGAACAAG - UNI14

894 - GATGTATTTATACCTCAAGATGGGAAGAAGGTGACGTGGTACTGTTGCGGGCCGACTGTCTATGATGCGTCTCACATGGGACATGCCAG GTCC

TACATCTCCTTCGATATCCTGAGGAGGGTGCTGAGGGATTACTTCCAGTATGATGTCTTTTACTGCATGAACATCACAGACATTGATGATAAG ATCATC

AGGCGGGCACGGCAGAACTACCTGTTTGAGCAGTATCGGGAGCAGAAACCCCCAGCCACCCAGCTCCTGAAGGATGTCCGTGATGCCATGAAG CCATTT

TCAGTCAAGTTAAGTGAGACAACAGATCCCGACAAGAGGCAGATGCTGGAGCGGATCCAGAACTCTGTGAAACTTGCCACAGAACCACTGGAACAGGCTG

TGCGATCCAGCCTCTCTGGAGAGGAAGTAGACAGCAAAGTACAG GTGTTGCTGGAGGAAGCAAAGGACTTGCTCTCTGACTGGCTGGATTCCACAGGTG

GCAGTGAGGTGACTGACAACTCGATTTTCTCCAAACTGCCCAAGTTCTGGGAAGAAGAGTTCCACAAAGACATGGAAGCCCTGAAT GTTCTCCCTCCTG

ATGTCCTAACCCGTGTCAGTGAATATGTGCCAGAAATTGTGAACTTCGTCCAGAAGATTGTGGACAATGGTTATGG TTATGCTTCAAATGGATCTGTTT

ACTTCGACACAGCCAAGTTTGCTGCTAGTGAAAAGCACTCCTATGGGAAGCTGGTGCCTGAGGCCGTTGGGGATCAGAAGGCACTTCAGGAAGGGGAAG 

GTGATCTGAGCATCTCTGCTGACCGCCTTAGTGAGAAACGCTCTCCCAATGACTTTGCCTTGTGGAAGGCCTCCAAGCCAGGCGAGCCATCCTGGCCTTG

CCCCTGGGGAAAG GGTCGTCCCGGATGGCACATAGAGTGTTCTGCTATGGCAGGCACGCTCCTGGGAGCCTCAATGGACATTCATGGTGGAGGGTTTGA

CCTCCGCTTCCCCCACCATGACAATGAGCTGGCACAGTCGGAG GCCTACTTTGAAAATGACTGCTGGGTCAGGTACTTCTTGCACACGGGCCACTTGAC

GATAGCAGGCTGCAAGATGTCCAAGTCACTGAAAAACTTTATCACCATTAAAGATGCCTTGAAGAAGCACTCAG CACGGCAGCTGCGACTGGCATTCCT

CATGCACTCATGGAAAGACACACTGGACTATTCCAGCAACACTATGGAGTCTGCTCTTCAGTATGAAAAATTCATGAAC GAGTTTTTCTTAAATGTGAA

AGACATCCTCCGAGCCCCTGTAGACATCACTGGCCAGTTTGAAAAGTGGGAAGCTGAAGAAGTGGAGCTAAATAAGAA CTTCTATGGCAAGAAGACCGC

AGTTCACGAAGCCTTGTGTGATAACATTGACACCCGGACTGTCATGGAAGAGATGCGGGCTTTGGTCAGTCAGTGCAACCTCTACATGGCAGCCAGGAAG

GCTGAACGGAGGAGGCCCAACCGGGCTCTGCTGGAGAACATTGCCATGTACCTCACCCACATGCTGAAG ATCTTTGGGGCCATAGAGGAGGAGAGCCCC

CTGGGGTTCCCAGTTGGTGGGCCTGGAACCAACCTGAAC CTCGAGTCAACAGTCATGCCCTACCTTCAGGTGTTATCAGAATTCAGAGAGGGAGTACGA

AAGATTGCCCGAGAGAAAAAAG TTCTTGAGGTTCTACAGCTCAGTGATGCCCTCCGGGATGACATCCTGCCTGAGCTTGGGGTCCGGTTTGAAGACCAT

GAAG GGCTGCCAACAGTGGTGAAGTTGGTGGACAGAGACACCTTACTGAAAGAGAAGGAAGGAAAGAAAAGG GCTGAAGAAGAGAAGAGGAGGAAGAA

AGAGGAGGCGGCCAGAAAGAAACAGGAGCAAGAA GCAGCAAAGCTGGCCAAGATGAAGATACCACCCAGTGAGATGTTCCTGTCAGAAGTCAACAAGTA

TTCTAAATTTGATGAAAAT - UNI19595 - GGTCTGCCTACCCACGACACCGAAGGCAAAGAGCTGAGCAAGGGCCAGGCCAAGAAGCTGAAGAAGC

TCTTTGAAGCCCAGGAGAAACTGTACAAGGAGTATCTGCAAATGTTACAGAATGGCAGCCTCCAGTGATGCCACGGCAGCCCAGGAGGGGCGCACCTGCC

AGCCTGGCTGCTATGGACTAGGCCACAGCTACTGAGGCTCCGTGCCCTGATCATGTTTACAGCTGTTCTCACACCTGAATCAGGCAGAGTGGTAGCAGCT

CTGGGACACTGATAATAAATTCTTCTGAACGGTG
Translation
MAGSSAEQG - UNI154 - - UNI14894 - GKGRRVQPQWSPPAGTEPCRLRLYNSLTRNK - UNI14894 - DVFIPQDGKKVTWYCCGPTVY

DASHMGHAR RSYISFDILRRVLRDYFQYDVFYCMNITDIDDK IIRRARQNYLFEQYREQKPPATQLLKDVRDAMK PFSVKLSETTDPDKRQMLERIQ

NSVKLATEPLEQAVRSSLSGEEVDSKVQ VLLEEAKDLLSDWLDSTGGSEVTDNSIFSKLPKFWEEEFHKDMEALN VLPPDVLTRVSEYVPEIVNFVQK

IVDNGYG GYASNGSVYFDTAKFAASEKHSYGKLVPEAVGDQKALQEGEG GDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGK GRPGWHIECS

AMAGTLLGASMDIHGGGFDLRFPHHDNELAQSE AYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALKKHSA ARQLRLAFLMHSWKDTLDYSS

NTMESALQYEKFMN EFFLNVKDILRAPVDITGQFEKWEAEEVELNKN NFYGKKTAVHEALCDNIDTRTVMEEMRALVSQCNLYMAARKAERRRPNRAL

LENIAMYLTHMLK IFGAIEEESPLGFPVGGPGTNLN LESTVMPYLQVLSEFREGVRKIAREKKV VLEVLQLSDALRDDILPELGVRFEDHEG GLPT

VVKLVDRDTLLKEKEGKKR AEEEKRRKKEEAARKKQEQE AAKLAKMKIPPSEMFLSEVNKYSKFDEN - UNI19595 - GLPTHDTEGKELSKGQA

KKLKKLFEAQEKLYKEYLQMLQNGSLQ

For any suggestions or comments, please send an email to unitrap@crg.es