Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011148 (Adssl1)
Chromosomal location
Chr 12: 113858256 - 113879550 (+)
Description
adenylosuccinate synthetase like 1 Gene [Source:MGI Symbol;Acc:MGI:87947]
RefSeq_dna
NM_007421 
RefSeq_peptide
NP_031447.1 
UniGene
Mm.3440 
MGI
MGI:87947 
Uniprot/SWISSPROT
P28650 
Uniprot/SPTREMBL
Q3UBP0 
Human Ortholog
ENSG00000185100 (ADSSL1)
Omim not available
UniTrap UNI28910
Vector Insertion
Chr 12: 113877973 - 113879168
Public Clones not available
Private Clones OST16813 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021726
Sequence
GCATTTAATGGAGCGAGAGCTCTGGCGGCGGCGGGCTCTCGCTTGGCCCAGAGCAGCAGAGGAGCTAAGCCAGCATGTCCGGGACCCGAGCCTCCAACGA

CCGGCCCCCCGGCACAGGCGGAGTCAAGAGGGGGCGGCTGCAGCAGGAGGCGGCGGCGACAGGCTCCCGCGTGACCGTGGTGCTGGGCGCGCAGTGGGGG

GACGAGGGCAAAGGCAAGGTGGTGGACCTGCTGGCCACGGACGCCGACATCGTCAGTCGCTGCCAG GGGGGCAACAATGCGGGGCACACAGTAGTGGTG

GACGGCAAGGAGTATGACTTTCACCTGCTCCCCAGCGGCATCATCAACACCAAGGCCGTGTCATTCATTG GCAATGGCGTGGTCATCCACTTGCCGGGC

TTGTTTGAAGAGGCAGAGAAGAACGAGAAGAAAG GGCTGAAGGACTGGGAGAAGCGTCTCATCATCTCTGACCGGGCTCACCTTG TGTTCGACTTCCA

CCAGGCAGTGGACGGGCTGCAGGAAGTACAACGTCAAGCACAAGAGGGGAAGAA TATCGGCACCACCAAGAAGGGAATCGGACCAACTTACTCCTCCAA

AGCTGCCCGGACAGGCCTCCGCATCTGTGACCTTCTCTCGGATTTTGACGAGTTTTCTGCCAG ATTCAAGAACCTGGCCCACCAGCACCAGTCCATGTT

CCCCACCCTGGAAATAGATGTGGAAGGTCAACTCAAAAGGCTCAAG GGCTTTGCTGAGCGCATCAGACCCATGGTTCGAGATGGTGTCTACTTCATGTA

TGAAGCCCTGCATGGTCCCCCCAAAAAGGTCCTGGTGGAAGGTGCCAACGCGGCCCTGCTCGACATCGATTTCG GGACCTACCCCTTTGTGACTTCTTC

CAACTGCACTGTGGGTGGTGTGTGCACCGGCCTGGGCATCCCGCCCCAGAACATAGGCGATGTGTATGGTGTGGTAAAGGCCTACACCACCCGTGTGGGC

ATTGGGGCCTTCCCCACGGAGCAGATCAAT GAAATTGGAGATCTGCTGCAGAACCGTGGCCATGAGTGGGGGGTGACCACAGGCAGGAAGAGGCGCTGC

GGCTGGCTGGACCTGATGATCCTCCGATACGCTCACATGGTCAATGGCTTCACTGC GCTGGCATTGACCAAGCTGGACATACTGGATGTCCTGAGCGAG

ATTAAAGTTGGCATCTCCTACAAGCTCAACGGAAAGAGGATTCCCTACTTCCCTG CTAACCAGGAGATCCTGCAGAAGGTGGAGGTCGAGTATGAAACA

CTGCCTGGATGGAAAGCAGACACCACAGGCGCCAGGAAGTGGGAGGACCTGCCTCCGCAGGCCCAAAGCTACGTGCGCTTCGTGGAGAATCACATGGGTG

TTGCAG - UNI28910 - TCAAATGGGTCGGCGTTGGGAAGTCCAGAGAGTCCATGATCCAGCTTTTTTAGATGCCAAGTGGAAGCCGGCAGGCCACA

CCACAGTGTGCCACCGTGAGTGACAGCCGCAGCCGAGACCCTCGGCAGTGCCACCAACACCTTCAACGAAACAGTCTGAAGCTATTTTCCATACTTTTAT

TTTTCTATGTATGTTTTCAGCTTGAAATTGTTGAGCCCTACAACAATTTTACATGTGTGAAATCAACACTGTGTACATTTAAAAAAAAATCTGCTTTTAA

AATGAGCCTAAGTGCTCATAACAGAGGCCTTCACTGACTGATTGTCACATGGTATGTGTTCAGTTGGAGCCATGTCATAATAAACATAGCCAGGGGTCAC

TG
Translation
MSGTRASNDRPPGTGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQ GGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIG

 GNGVVIHLPGLFEEAEKNEKKG GLKDWEKRLIISDRAHLV VFDFHQAVDGLQEVQRQAQEGKN NIGTTKKGIGPTYSSKAARTGLRICDLLSDFDE

FSAR RFKNLAHQHQSMFPTLEIDVEGQLKRLK GFAERIRPMVRDGVYFMYEALHGPPKKVLVEGANAALLDIDFG GTYPFVTSSNCTVGGVCTGLGI

PPQNIGDVYGVVKAYTTRVGIGAFPTEQIN EIGDLLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTA ALALTKLDILDVLSEIKVGISYKLNG

KRIPYFPA ANQEILQKVEVEYETLPGWKADTTGARKWEDLPPQAQSYVRFVENHMGVAV - UNI28910 - VKWVGVGKSRESMIQLF
Transcript ENSMUST00000109756
Sequence
GCATTTAATGGAGCGAGAGCTCTGGCGGCGGCGGGCTCTCGCTTGGCCCAGAGCAGCAGAGGAGCTAAGCCAGCATGTCCGGGACCCGAGCCTCCAACGA

CCGGCCCCCCGGCACAGGCGGAGTCAAGAGGGGGCGGCTGCAGCAGGAGGCGGCGGCGACAGGCTCCCGCGTGACCGTGGTGCTGGGCGCGCAGTGGGGG

GACGAGGGCAAAGGCAAGGTGGTGGACCTGCTGGCCACGGACGCCGACATCGTCAGTCGCTGCCAG GGGGGCAACAATGCGGGGCACACAGTAGTGGTG

GACGGCAAGGAGTATGACTTTCACCTGCTCCCCAGCGGCATCATCAACACCAAGGCCGTGTCATTCATTG GCAATGGCGTGGTCATCCACTTGCCGGGC

TTGTTTGAAGAGGCAGAGAAGAACGAGAAGAAAG GGCTGAAGGACTGGGAGAAGCGTCTCATCATCTCTGACCGGGCTCACCTTG AAAATGAAGTCCC

TCACAAACCTCTGCCCTCTGCTTCTCTCCTGCCCATGTGCTGGCTGCTGGCACCAGTGTTCGACTTCCACCAGGCAGTGGACGGGCTGCAGGAAGTACAA

CGTCAAGCACAAGAGGGGAAGAA TATCGGCACCACCAAGAAGGGAATCGGACCAACTTACTCCTCCAAAGCTGCCCGGACAGGCCTCCGCATCTGTGAC

CTTCTCTCGGATTTTGACGAGTTTTCTGCCAG ATTCAAGAACCTGGCCCACCAGCACCAGTCCATGTTCCCCACCCTGGAAATAGATGTGGAAGGTCAA

CTCAAAAGGCTCAAG GGCTTTGCTGAGCGCATCAGACCCATGGTTCGAGATGGTGTCTACTTCATGTATGAAGCCCTGCATGGTCCCCCCAAAAAGGTC

CTGGTGGAAGGTGCCAACGCGGCCCTGCTCGACATCGATTTCG GGACCTACCCCTTTGTGACTTCTTCCAACTGCACTGTGGGTGGTGTGTGCACCGGC

CTGGGCATCCCGCCCCAGAACATAGGCGATGTGTATGGTGTGGTAAAGGCCTACACCACCCGTGTGGGCATTGGGGCCTTCCCCACGGAGCAGATCAAT 

GAAATTGGAGATCTGCTGCAGAACCGTGGCCATGAGTGGGGGGTGACCACAGGCAGGAAGAGGCGCTGCGGCTGGCTGGACCTGATGATCCTCCGATACG

CTCACATGGTCAATGGCTTCACTGC GCTGGCATTGACCAAGCTGGACATACTGGATGTCCTGAGCGAGATTAAAGTTGGCATCTCCTACAAGCTCAACG

GAAAGAGGATTCCCTACTTCCCTG CTAACCAGGAGATCCTGCAGAAGGTGGAGGTCGAGTATGAAACACTGCCTGGATGGAAAGCAGACACCACAGGCG

CCAGGAAGTGGGAGGACCTGCCTCCGCAGGCCCAAAGCTACGTGCGCTTCGTGGAGAATCACATGGGTGTTGCAG - UNI28910 - TCAAATGGGTC

GGCGTTGGGAAGTCCAGAGAGTCCATGATCCAGCTTTTTTAGATGCCAAGTGGAAGCCGGCAGGCCACACCACAGTGTGCCACCGTGAGTGACAGCCGCA

GCCGAGACCCTCGGCAGTGCCACCAACACCTTCAACGAAACAGTCTGAAGCTATTTTCCATACTTTTATTTTTCTATGTATGTTTTCAGCTTGAAATTGT

TGAGCCCTACAACAATTTTACATGTGTGAAATCAACACTGTGTACATTTAAAAAAAAATCTGCTTTTAAAATGAGCCTAAGTGCTCATAACAGAGGCCTT

CACTGACTGATTGTCACATGGTATGTGTTCAGTTGGAGCCATGTCATAATAAACATAGCCAGGGGTCACTG
Translation
MSGTRASNDRPPGTGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQ GGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIG

 GNGVVIHLPGLFEEAEKNEKKG GLKDWEKRLIISDRAHLE ENEVPHKPLPSASLLPMCWLLAPVFDFHQAVDGLQEVQRQAQEGKN NIGTTKKGIG

PTYSSKAARTGLRICDLLSDFDEFSAR RFKNLAHQHQSMFPTLEIDVEGQLKRLK GFAERIRPMVRDGVYFMYEALHGPPKKVLVEGANAALLDIDFG

 GTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQIN EIGDLLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTA ALA

LTKLDILDVLSEIKVGISYKLNGKRIPYFPA ANQEILQKVEVEYETLPGWKADTTGARKWEDLPPQAQSYVRFVENHMGVAV - UNI28910 - VKW

VGVGKSRESMIQLF

For any suggestions or comments, please send an email to unitrap@crg.es