Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011256 (Adam19)
Chromosomal location
Chr 11: 45869489 - 45960845 (+)
Description
a disintegrin and metallopeptidase domain 19 (meltrin beta) Gene [Source:MGI (curated);Acc:Adam19-001]
RefSeq_dna
NM_009616 
RefSeq_peptide
NP_033746.1 
UniGene
Mm.89940 
MGI
MGI:105377 
Uniprot/SWISSPROT
O35674 
Uniprot/SPTREMBL
Q14BL7 Q3UH67 Q3UHT3 Q80UF6 
Human Ortholog
ENSG00000135074 (ADAM19)
Omim not available
UniTrap UNI10555
Vector Insertion
Chr 11: 45869488 - 45869713
Public Clones G035D10 (ggtc) G071H03 (ggtc) P069G12 (ggtc) G032H10 (ggtc) G043E07 (ggtc)
G031H04 (ggtc) G066A06 (ggtc) M117B02 (ggtc) G035D07 (ggtc) G067E01 (ggtc)
G076A02 (ggtc) G066E03 (ggtc) G056G11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29581
Vector Insertion
Chr 11: 45869713 - 45874424
Public Clones E324H11 (ggtc) IST11816C10 (tigm) IST14733G4 (tigm) IST13101C11 (tigm)
IST10820H3 (tigm) IST11710F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10523
Vector Insertion
Chr 11: 45874853 - 45878513
Public Clones (sanger) G046H05 (ggtc) G042G05 (ggtc) P071G09 (ggtc) G076H07 (ggtc)
G061D01 (ggtc) G077A07 (ggtc) G053D09 (ggtc) G043H10 (ggtc) G065E12 (ggtc)
G033F11 (ggtc) G044D03 (ggtc) G033B10 (ggtc) G071B11 (ggtc) G054B01 (ggtc)
G071C01 (ggtc) G044F06 (ggtc) G059C10 (ggtc) G043B04 (ggtc) M090F01 (ggtc)
G033D06 (ggtc) P069B06 (ggtc) G031G03 (ggtc) G065H09 (ggtc) G053F03 (ggtc)
G066F01 (ggtc) G035C09 (ggtc) CMHD-GT_473G7-3 (cmhd) IST10516H4 (tigm)
IST10736D5 (tigm) IST12246D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10538
Vector Insertion
Chr 11: 45878585 - 45907364
Public Clones (sanger) P070D09 (ggtc) P070B12 (ggtc) G066D03 (ggtc) P070H03 (ggtc)
P074D12 (ggtc) G046H03 (ggtc) G054A06 (ggtc) P069H10 (ggtc) P070A12 (ggtc)
G076G05 (ggtc) P069D01 (ggtc) G076A03 (ggtc) G024C08 (ggtc) G040A02 (ggtc)
G053E09 (ggtc) P070F10 (ggtc) P074A11 (ggtc) M098C01 (ggtc) G065G10 (ggtc)
CMHD-GT_494B10-3 (cmhd) IST10676B12 (tigm) IST10683B12 (tigm) IST10212H9 (tigm)
Private Clones OST451149 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11681
Vector Insertion
Chr 11: 45907444 - 45913354
Public Clones G071H01 (ggtc) P075F09 (ggtc) IST10549C12 (tigm) IST12005E1 (tigm)
Private Clones OST297083 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25472
Vector Insertion
Chr 11: 45913432 - 45926258
Public Clones IST14707A5 (tigm) IST10722A11 (tigm) IST12863E2 (tigm) IST11656D4 (tigm)
Private Clones OST182648 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11144
Vector Insertion
Chr 11: 45926452 - 45927124
Public Clones G075H10 (ggtc) G052H07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11109
Vector Insertion
Chr 11: 45927191 - 45931921
Public Clones G040G07 (ggtc) P071E12 (ggtc) P073H10 (ggtc) P080A11 (ggtc) P072D10 (ggtc)
G084D11 (ggtc) P076B06 (ggtc) P073H08 (ggtc) G052A03 (ggtc) P072C09 (ggtc)
G080D05 (ggtc) P075E01 (ggtc) P072F09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11141
Vector Insertion
Chr 11: 45931994 - 45934921
Public Clones G052H03 (ggtc) P085C03 (ggtc) M090A02 (ggtc) G052E04 (ggtc) P085A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11230
Vector Insertion
Chr 11: 45935089 - 45936594
Public Clones G033A09 (ggtc) IST10002G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11203
Vector Insertion
Chr 11: 45936680 - 45938509
Public Clones G085F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10635
Vector Insertion
Chr 11: 45938650 - 45940747
Public Clones (sanger) P070D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10228
Vector Insertion
Chr 11: 45945321 - 45947929
Public Clones PST066 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109251
Sequence
TTGCGGACAGTGAGAGGGCCGTTGCTATCATGCCCGGGCGCGCGGGCGTCGCCCGGTTCTGCTTGCTGGCTCTCGCTCTGCAGCTACATTGGCCGCTGGC

GGCGTGCGAGCCGGGATGGACCACAA - UNI10555 - - UNI29581 - GAGGAAGCCAAGAAGGTAGCCCTCCGCTACAGCATGAACTCATAATA

CCTCAGTGGCGGACTTCAGAAAGCCCTGGGAGAGGAAAGGTAAGATGTCCAAGCTCCTTGGAGAAGCAGGAATGACAGTTCCTCTAGCTGTGTCAACTTA

GGATATCTTAGCGGGGACTTTCCTTCACTCTATGACGAACTCGTAGACCCATTCCCAAGCCCTTGTAGTTGAGGAAATGAAAATTCACAGTAACACACGA

ACTGGGCTGGAGAGATGGTTTAGCAGTTAAGAGCACTTGCTGTTCTTGATAGAACTGGGGTTCAGGTCCAAGCATCCAGAGGATGGTTCACAATCATCTG

TAACTCCAGTTCCAGGAGATGCCTCTGAGGGCACCGGGCATGCATATGGTGCTCATACATATATGTAGGCAAAACACTCAT - UNI10228 - - UNI

10523 - - UNI10538 - - UNI10635 - - UNI11109 - - UNI11141 - - UNI11144 - - UNI11203 - - UNI11230 - -

 UNI11681 - - UNI25472 - GTGTGTGAAAGAGACAGAGGCAATGAGAGAGACAGACATGCAGGCAGGCCGACAGCTCTGCATGTACTTGTGTTT

TACGGCCTCAAGCAGAATAAGGGACCTCCTCCTTATTTCTGACTCATATCTAAGTAAGGTTCCCCAGGACAGCCACAGTTGTACTGAGGGGGGCTGACAT

GTTTGGCATCCTGGCTATAGTATTGTATACACAGGGCCACCAGCCCCGCCCTAGTGGTCAGCTCTGAGGGGGGACTGGTGACTCTGAACAGATCGATGTC

AACAGCCATGGTGAACCAGATCTGGGCAGGGTTCCCCAAACTCTATTCAACCAGAGTTTTATCACGCACCTCATCGGGTCTCTCCTGGTTGCTGCCCCGA

GGTGATCGTCATGGAAAATGCTGAGAAGGTGGGAATGGGATGGGGTGGACCTTCTCTTGCTTGGTGCTCCGCTATTTGGAACAGTTCTTACACATTTGCT

GGGCCTGGCCTCTGAGAGGCCATCTTCCACCCCCAGAAAGGTGCTAATGGCACTGCAGAGGGCTCTCTAGGGGCCTCCCCGCCCCAACAGCAAGCAGTTG

TTAGCTCTTGGAACCCTCCAGAGGAAGAGGCAAGCGTTTGACTTCCCCTTTACCACCTGAGGCCTCCTTATATCTCTTCCCAGAGTAAGCTTTGGGATTG

TAGACATGTGGGAGCTATGACAGACGTGGCCTGGGGTAGAAAGATCTCAGGAAAGCACCTTTCTCCTTTTCAGGGTGACCGTGCTCTTCACACTCTCTGA

GGCCTCAGTCCATGTCCTATATCAGTTTCTCTTTTGTGTGCTTTACCAAGTGGCCGGTG
Translation
MPGRAGVARFCLLALALQLHWPLAACEPGWTTR - UNI10555 - - UNI29581 - RGSQEGSPPLQHELIIPQWRTSESPGRGKVRCPSSLEKQE

 - UNI10228 - - UNI10523 - - UNI10538 - - UNI10635 - - UNI11109 - - UNI11141 - - UNI11144 - - UNI112

03 - - UNI11230 - - UNI11681 - - UNI25472 - 
Transcript ENSMUST00000011400
Sequence
GCGTCTGGGATGTGGGCTGGGTGGCTTTTAGGCCGGCGTTTGCTTGAAAACCTCCGCCGCCGCTAGGCCGGGGGCAGGCAATGGCAGGGGATGTGTGATT

GCGGACAGTGAGAGGGCCGTTGCTATCATGCCCGGGCGCGCGGGCGTCGCCCGGTTCTGCTTGCTGGCTCTCGCTCTGCAGCTACATTGGCCGCTGGCGG

CGTGCGAGCCGGGATGGACCACAA - UNI10555 - - UNI29581 - GAGGAAGCCAAGAAGGTAGCCCTCCGCTACAGCATGAACTCATAATACC

TCAGTGGCGGACTTCAGAAAGCCCTGGGAGAGGAAAG - UNI10523 - CATCCACTCAGAGCAGAGCTCAGGGTCATGGCTGAAGGGCGAGAGCTGA

TCCTAGACCTGGAGAAGAACGA - UNI10538 - GCACCTTTTTGCTCCAGCCTACACAGAAACCTGCTACACTGCAAGTGGCAATCCTCAAACCAGC

ACGCTGAAGTCTGAG - UNI11681 - GATCACTGCTTTTACCACGGGACTGTGAGGGACGTGGATGAGTCCAGTGTCACGCTCAGCACCTGCCGGGG

AATTAG - UNI25472 - AGGACTGATTATAGTGAGAAGTAACCTCAGCTACATCATCGAGCCCGTCCCTAACAGCGACAGCCAACACCGTATTTACA

GATCCGAACATCTCACGCTGCCCCCGGGGAACTGTGGGTTCGAGCACTCCGGGCCCACCTCGAAGGACTGGGCCCTTCAGTTTACACATCAGACCAAAAA

GCAACCTCGCAGA - UNI11144 - ATGAAACGGGAAGATCTACACTCTATGAAGTACGTGGAGCTTTACCTGGTGGCTGATTATGCAGAG - UNI1

1109 - TTTCAGAAGAATCGACATGACCAGGATGCCACCAAACGCAAGCTCATGGAGATTGCCAACTATGTTGATAAG - UNI11141 - TTTTACC

GCTCCCTGAACATCCGAATTGCACTTGTCGGCTTGGAGGTGTGGACGCATGGGGATAAGTGTGAAGTTTCAGAGAATCCCTACTCTACCCTCTGGTCCTT

TCTTAGTTGGAGGCGCAAGCTGCTTGCTCAGAAGAGCCATGACAATGCTCAGCTAATCAC - UNI11230 - GGGCAGGTCCTTCCAAGGCACCACCA

TTGGCCTGGCCCCCCTCATGGCCATGTGCTCCGTGTACCAGTCTGGAGGAGTTAGCATG - UNI11203 - GACCACTCCGAGAATGCCATTGGTGTA

GCCTCCACTGTGGCCCATGAGATTGGCCACAACTTTGGCATGAGCCATGATTCTGCACACTGCTGTTCTGCCAGTGCAGCCGATGGCGGCTGCATCATGG

CCGCCGCCACCGG - UNI10635 - GCACCCTTTCCCCAAAGTGTTCAGTTGGTGTAACAGGAAGGAGCTGGACAGGTATCTGCAGACAGGAGGAGGG

ATGTGTCTCTCCAACATGCCGGACACTAGGACGCTGTATGGAGGCCGGAGGTGTGGCAACGGGTACCTGGAAGACGGTGAAGAATGTGACTGTGGAGAAG

AGGAG GAATGTAAGAACCCTTGCTGCAATGCCTCCAACTGCACTCTGAAGGAAGGGGCAGAGTGTGCCCATGGTTCCTGCTGCCACCAGTGCAAG CTG

GTGGCTCCTGGAACCCAGTGTCGGGAGCAGGTTCGGCAATGTGACCTCCCCGAGTTCTGCACCGGCAAGTCTCCCCACTGCCCCACCAACTATTATCAGA

TGGATGGCACCCCCTGCGAGGGTGGCCAGGCCTACTGCTACAACGGCATGTGCCTCACTTACCAGGAACAGTGCCAGCAGCTGTGGGGACCTG - UNI1

0228 - GAGCCCGGCCTGCCCTCGATCTTTGCTTTGAGAGGGTGAATGCTGCTGGTGACACCTATGGAAACTGTGGCAAGGGCTTGAATGGCCAATACA

GGAAGTGCAGTCCCAG GGATGCCAAGTGTGGGAAGATTCAGTGCCAGAGCACCCAGGCCCGGCCCCTGGAATCCAACGCAGTATCTATTGACACCACCA

TCACCTTGAACGGGAGGCGGATCCACTGTCGGGGCACCCACGTCTACCGGGGTCCTGAGGAGGAGGAAGGGGAAGGTGACATGCTGGACCCAGGGCTGGT

GATGACTGGAACCAAGTGTGGCCACAACCAT ATTTGCTTCGAGGGGCAGTGCAGGAACACCTCCTTCTTTGAGACGGAAGGCTGTGGGAAAAAGTGCAA

TGGCCACGGG GTCTGCAACAACAACAAGAACTGTCATTGCTTCCCTGGCTGGTCTCCACCTTTCTGTAACACCCCGGGAGATGGTGGCAGCGTCGACAG

TGGTCCTTTGCCCCCTAAGA GTGTGGGTCCCGTGATCGCTGGGGTGTTTTCAGCTCTCTTCGTGTTGGCAGTTCTGGTGCTACTGTGTCACTGCTACAG

ACAGAGCCACAAACTGGGCAAACCCTCGGCTCTCCCTTTCAAGCTGCGGCATCAGTTCAG TTGTCCCTTCAGGGTATCTCAGAGTGGTGGAACTGGCCA

TGCCAACCCAACTTTCAAGTTGCAGACCCCCCAGGGCAAGCGAAAG GTGACTAACACCCCTGAATCCCTCCGGAAGCCGTCCCACCCCCCTCCCCGGCC

CCCTCCAGACTACCTGCGCGTTGAATCGCCACCTGCACCATTGCCGGCACATCTGAACAGGGCTGCTGGGAGCTCCCCAGAAGCTGGGGCTCGAATAGAA

AGAAAGGAGTCAGCCAGGAGGCCTCCCCCAAGCCGACCCATGCCCCCTGCACCTAACTGCCTACTGTCCCAG GACTTCTCCAGGCCTCGACCACCTCAG

AAGGCACTCCCAGCCAATCCGGTGCCAGGCCAAAGGACCGGTCCCAGGTCAGGAGGCACCTCCCTGCTTCAGCCCCCTACTTCTGGTCCTCAGCCCCCCA

GGCCTCCAGCAGTGCCTGTTCCAAAG CTACCCGAGTACCGATCACAGAGGGTTGGAGCAATAATTAGCTCCAAGATCTAGAAGTGTCGAGAAGTTTCTT

GTTCCGATGGAAGACTCCGGATGCCATGGAAGGTCCAGAAGAAAGACGCCTTCTCACCCATCCTGAAGCTTTGGCAGCCTTCTGGAACGTCCCTCATCCC

CAGAATCTCCCTTCTTACCCGAGTGCCTCCTGCTTCCTCCGAGGCCCAGGGGGACTCATATCCAATGGCTCCTAAGTGTTTGTCCTGTGCAATATACAGC

CCAGGGAGGGAAGGGAAGCACGGCGAGGAGGGTGGGAAAGGTTCTCCCTCAGCCCACTAGCCAAGAGCTACCAGCGATGCTCAGGGAAGGCTTGAGCTGG

GGTCCTCCTCTGCGGAGCTTGGAGAAGGTACCCATCCTGGTCCTATGCTGGCAGGAACACACGCGAGTGTCACTGATTGGCCTCCTTCTGGGATCCCAGG

CTGCTGAGGAAGCTACTGCTACATCCCTACCCCAAGGGGCTTGGTCAAGGTGCCTGTTCCTGGCTCTCTGGCTGCATGTGATAAGCCATGCTCCCCTCCC

CTGCCTTTCTTCACATTCCCACTCCCATATTTACACGGGTCACTCTGACTCAGACAGGTACTATTTGTAAGTAGCATAGACAGCAGGGGGGTGGGGTGGT

CAACCTGTGTCCCCTCTGAGCCGTTATGCCAAAGGTCACTAAGGACATTTAGAATCCCCATCCATCCATCCATCCATCCATCCATCCATCCATTCATCCA

TCCCCAGTGTTCCATGTGTCACCTTCTCCTTTTCCAGCATCCCTATCCTATGGTGCTTTGGTGGTGAACTATGGCAGTCCTGACTTGCTGATGACCATAT

GCTGGTGACCTACAAATCGGGATCCTGCCATATGGGGTCGCCACTGGACTTTCTGCACTGGATCTCAAGAGCGTTGAGCCGAGTGGGCGTGTATGTGTGT

GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGAAAGAGACAGAGGCAATGAGAGAGACAGACATGCAGGCAGGCCGACAGCTCTGCA

TGTACTTGTGTTTTACGGCCTCAAGCAGAATAAGGGACCTCCTCCTTATTTCTGACTCATATCTAAGTAAGGTTCCCCAGGACAGCCACAGTTGTACTGA

GGGGGGCTGACATGTTTGGCATCCTGGCTATAGTATTGTATACACAGGGCCACCAGCCCCGCCCTAGTGGTCAGCTCTGAGGGGGGACTGGTGACTCTGA

ACAGATCGATGTCAACAGCCATGGTGAACCAGATCTGGGCAGGGTTCCCCAAACTCTATTCAACCAGAGTTTTATCACGCACCTCATCGGGTCTCTCCTG

GTTGCTGCCCCGAGGTGATCGTCATGGAAAATGCTGAGAAGGTGGGAATGGGATGGGGTGGACCTTCTCTTGCTTGGTGCTCCGCTATTTGGAACAGTTC

TTACACATTTGCTGGGCCTGGCCTCTGAGAGGCCATCTTCCACCCCCAGAAAGGTGCTAATGGCACTGCAGAGGGCTCTCTAGGGGCCTCCCCGCCCCAA

CAGCAAGCAGTTGTTAGCTCTTGGAACCCTCCAGAGGAAGAGGCAAGCGTTTGACTTCCCCTTTACCACCTGAGGCCTCCTTATATCTCTTCCCAGAGTA

AGCTTTGGGATTGTAGACATGTGGGAGCTATGACAGACGTGGCCTGGGGTAGAAAGATCTCAGGAAAGCACCTTTCTCCTTTTCAGGGTGACCGTGCTCT

TCACACTCTCTGAGGCCTCAGTCCATGTCCTATATCAGTTTCTCTTTTGTGTGCTTTACCAAGTGGCCGGTGACTACAGGCCACCCCGATTCTCACCACA

AAGTTAGAAACCCTCCACTTTCTGTCCCTTGAACCATATCAGAAAAAGACCCATTTCCTTGCTCTTTGGTAATCACTTCTGTTTTTTTCTTTTTCATTAC

TTTGCTACCACCTCCATCCCATGACATTATACTGTGAAGTGTAAGAGGACGGGGTTTTTTTAAACTTGGTAGAAATGTCGGCAGCTGCTCTACACACAAC

TTCACTCAAGGCTTTGTTTCCAGAGGCCAGCTAGGCTGTCACAGGCAGGAATCCCTTCCCATCTGCTTTGTGAAGGGTCCCATACAGGTGTATCTAGACT

TCAAGGACAGGGTTTGTCTCACAGGATTGTCACTTAGGAGATGAAAGAATATTACCACATGAGGAGGAGGGGCAGTTGCAACAGAACACTTTGGTCTTCC

TACACCAAGTCTGTGAGGGCATCCAAGACTGAATGAAAGCGCTTTTCTTATGCATACAATGTGAGCAAGAACAAGAACTGTTTAAGGCACCTCTGTTCCC

AGCCACTGAAGAGAGACGTCAGAAGATGTTAGAATAGGTCAAAGCCAAGGCTCTGGTGGGCTGAGGGAAGGTTTGTAGCTGCGTTTAGTGGTATACATCT

TTAGTCCCAGCATAGGCAGGTGAATCTCGAGTTTGAAGCTAGCCTGGTCTAAAAAGGAAGTTCCAAGACTGCCAGGGCCACACAGAGGAAAAAAAAAACC

CTCTAGAAAAACAAAAATGAAGACAGGATCTCATGTATCGTAGATTGGCCTTTAAGTCACTTTACCAAGGATGATCTTTGAACTCCTGAGTACAGACTGC

GGGTGTGTGCTACCATGCTTTATGTGGCCCTGGGTTCAAACACAGCCCTTCATATGTATATAGCCAAACACTCTACAACTGAGCTACATCCTCCAGCCTA

GGCTGTAAATGTTTTTTGGAGCTAGATTAGCTGCCTGCCAACCTTAGAACTGCAAAGCCATTCCTGACCTGTAAACCTCAGCTCTCCATCTCTATAAGAG

GTATAGCCTGGGCTAATACCGTCCAAGTTACAACTCCTTGCTTGCTTTCTGTTCCTTCTAGCCTTGGTGACTTCCACCAGGAAGAGAATACCCCCTCTCT

ACCCCTGCTCCAAGACACTGTAGATGCTAGTGTCGGAGTGTTCTCTGTAACGCGACAGTTCCTTCTGTTGCAATAGCCCCCCTGCAACACTGCAATAATC

CTTCAGTGTCTCCCCTGGGCTCAATTCACTTCCTTATTTGACAAAGTGGAGGTGAGACTTGTATTCTTAAAATTGGAGGCTAGTTATTTTGTCAAATGCA

TGTAATGAACAGACCCGAAGGAATCCTCCACACACAAGCCAGGGAACACCAACTGGAAAGGTACCCCGTCCCAGGGAAGCCTGCTAGGGAGAGGTTCTGT

AGAATCCGAGCCTAGCACCCCAAAGTCATGCACCCAGTATCCTCTTGTATGACTGTATATGTCTATGTCTGGGATCCAGGGCAAATGTGAATTTTCTTTT

GATTTGGGAGATTGTTCACAGGAAGTAGTCCTCCCCTCTCATGTCCTCCTATTGATTGTTTACAATATTTGTACATCTATGCAAAATACTTGAATGGGCC

ATGGTGCCTTGTTTTTTGTTGTTGTTGTTATTTTTTTCTCCTTGTTTGTATTTAATTAAAACAAATTGTCATGAGGAAA
Translation
MPGRAGVARFCLLALALQLHWPLAACEPGWTTR - UNI10555 - - UNI29581 - RGSQEGSPPLQHELIIPQWRTSESPGRGK - UNI10523

 - HPLRAELRVMAEGRELILDLEKNE - UNI10538 - EHLFAPAYTETCYTASGNPQTSTLKSE - UNI11681 - DHCFYHGTVRDVDESSVT

LSTCRGIR - UNI25472 - RGLIIVRSNLSYIIEPVPNSDSQHRIYRSEHLTLPPGNCGFEHSGPTSKDWALQFTHQTKKQPRR - UNI11144 -

 MKREDLHSMKYVELYLVADYAE - UNI11109 - FQKNRHDQDATKRKLMEIANYVDK - UNI11141 - FYRSLNIRIALVGLEVWTHGDKCEV

SENPYSTLWSFLSWRRKLLAQKSHDNAQLIT - UNI11230 - TGRSFQGTTIGLAPLMAMCSVYQSGGVSM - UNI11203 - DHSENAIGVAST

VAHEIGHNFGMSHDSAHCCSASAADGGCIMAAATG - UNI10635 - GHPFPKVFSWCNRKELDRYLQTGGGMCLSNMPDTRTLYGGRRCGNGYLEDG

EECDCGEEE ECKNPCCNASNCTLKEGAECAHGSCCHQCK LVAPGTQCREQVRQCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQEQC

QQLWGPG - UNI10228 - GARPALDLCFERVNAAGDTYGNCGKGLNGQYRKCSPR RDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRIHCRGT

HVYRGPEEEEGEGDMLDPGLVMTGTKCGHNH ICFEGQCRNTSFFETEGCGKKCNGHG VCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKS SVG

PVIAGVFSALFVLAVLVLLCHCYRQSHKLGKPSALPFKLRHQFS SCPFRVSQSGGTGHANPTFKLQTPQGKRK VTNTPESLRKPSHPPPRPPPDYLRV

ESPPAPLPAHLNRAAGSSPEAGARIERKESARRPPPSRPMPPAPNCLLSQ DFSRPRPPQKALPANPVPGQRTGPRSGGTSLLQPPTSGPQPPRPPAVPV

PK LPEYRSQRVGAIISSKI

For any suggestions or comments, please send an email to unitrap@crg.es