Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011382 (Dhdh)
Chromosomal location
Chr 7: 52728933 - 52744166 (-)
Description
dihydrodiol dehydrogenase (dimeric) Gene [Source:MGI (curated);Acc:Dhdh-001]
RefSeq_dna
NM_027903 
RefSeq_peptide
NP_082179.1 
UniGene
Mm.34208 Mm.415855 
MGI
MGI:1919005 
Uniprot/SWISSPROT
Q9DBB8 
Uniprot/SPTREMBL
Q8K0E9 
Human Ortholog
ENSG00000104808 (DHDH)
Omim not available
UniTrap UNI17188
Vector Insertion
Chr 7: 52743542 - 52744043
Public Clones IST13604G3 (tigm)
Private Clones OST447767 (lexicon) OST433844 (lexicon) OST319008 (lexicon) OST240346 (lexicon)
OST118808 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22907
Vector Insertion
Chr 7: 52742275 - 52743429
Public Clones not available
Private Clones OST281517 (lexicon) OST124225 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36297
Vector Insertion
Chr 7: 52737158 - 52742275
Public Clones IST11540H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31433
Vector Insertion
Chr 7: 52730974 - 52734504
Public Clones IST12375C9 (tigm) IST12375D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30801
Vector Insertion
Chr 7: 52728932 - 52731123
Public Clones IST14666F5 (tigm) IST12475C3 (tigm) IST12409G6 (tigm) IST13443A5 (tigm)
IST13378H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000011526
Sequence
GCCTCCGGCCCCCGCAGGCAGAAGACGTGCAAAATGGCGCTGCGCTGGGGCATCGTGTCGGCTGGCTTAATTGCCAACGACTTTACCACCGTGCTGAGCT

CACTGCCTTCCTCGGAGCACCAG - UNI17188 - GTGGTAGCGGTAGCTGCGAGGGACCTGAACCGGGCCGAGGAGTTCGCACAGAAATTCAACATC

CCCAAGGCCTATGGCTCTTATGAGGAACTGGCCAAGGACCCAAACGTGG - UNI22907 - AGGTGGCCTACATCGCCACCCAGCACCCCCAGCACAA

GCCAGCCGTACTCCTCTGCCTGGCAGCAGGCAAGGCTGTCCTTTGTGAGAAACCCATGGGCGTGAATGCAGCAGAAGTTCGGGAGATGGTTGCCAAAGCC

CGTTCTCAAGGCGTCTTCCTTATGGAG GCCATTTGGAGCCGATTTTTTCCTGCCATGGAGGCTCTGAGGGAAGTTTTAGTTCAAGGAACTATCGGAGAC

CTACGAGTGGCCCGGGCAGAATTCGGATTTGATTTAAGTCATATACCCCGGGCCACAGACTGGAACCAAGCCGGAGGTGGTCTGCTGGACCTAGGCATCT

ACTGTGTCCAGTTCTTATCCATGATCTTTGGTGCACAGAAGCCAGAGAAGATTTCAGCTGTTGGGAGGATCCATGAAACAG - UNI31433 - GTGTG

GATGACACTGTCAGCGTGCTACTTCAGTATCCAGGAGGGGTTCATGGCAGCTTCACCTGCAGCATCTCCTCCAACCTCCCCAACACAGCGTATGTGAGTG

GTACCAAGGGCATGGCCCAG - UNI30801 - - UNI31433 - ATTCAAAAATTGTGGGCCCCAACAGAGCTGGTGGTGAATGGAGAGAGGAAGGA

GTTCCCTCCGCCTGTCCTTGGGAAGGACTACAATTTTGTAAATGGGTCATGCATGCTCTATGAAGCCAACCACGTGCGTGAGTGCCTGCGTAAAG - UN

I30801 - - UNI31433 - GTCTTAAGGAGAGTCCTGTAGTTCCTCTGGCAGAGAGTGAGCTCTTGGCTGAGATCCTTGAGGAGGCGAGGAAGGCCA

TTGGAGTCACCTTCCCCCAGGATAAACGCTGATACAGCTCCTGCGACAGATGTGTGTGGCAAGCAACCTTCCCTCCTGCTTGGACCTCTGTAACCTGACT

CTCATTGCTTTGGAGTTGTTGTTGTTGTTGTTGTTGTTGCTGCTGCTGCTGCTGCAAATCAGCACGTGTTCTCTCCCTTTCTGGGTGTTGGGAGCCAGCT

TTGATGAGTCAGGGTGTGGAGTCAGGGGAGTCTACAGACACCAAAGCTTCTTTCTAGGACAAACAGGTTCTCTCTTTACTTTAGGGGGAAACACACGCAC

ACGCACACGCACACGCACACACACACACACACACTTGATGGATGAAGCTAGGCTCCAACAACTTTATTTTTCCCCCATATCCCCCAGCAAACTCTTTGAA

GAAGTATAAAAATTACAATGTGGTTACATTCTATCTTTAAGTGGATGAATAAATGAAGTACAATGAGTTCAAGTAAAAACAACAACTACAAAGCCCAGCA

GGCCCCCAGCACCCTTACACAATTAAGCAATTTATATATTACATGCAGAAAACAGATTATTAACATGAATCCACATACATTCCTGTCTAAGCAACTTGTT

ATAGACTAACAAACTGTGGGTAAAAAAGGTATTTTTTTCTCAGCCAGTTCTTTGACTGGCAAGCTGCAATTTGTGATTATGAAGAAAGGAACAATCATTT

TGTTATTTGTCCTGAAAAGTAATTTTTAAAATTATTCACTTTACACCCCAGTATCAGCCCCACCTATCTCCTCCCAGTCCTCCCTTCACACAGCTCAGCT

CCCCCCCCATTCCCTCTCTTCCTCTGAGAAGGGGGAAGCTCCCCTGGGTACCACACACACACACACACACACACACTCACACACACACACACAAACACAC

TCACACACACACACACACACACACACACAGCATATGGAGTCACTGCAGGACTAAGTGCATCCTCTCCCACTGAAGCCAGATGAAACAGCCCAGTTAGGGG

AATGGGATCCACAGGCAGGCAATAGATTCAGGAACTAAATGTAATCATAAAAAACTTAAAGAATCACAAATCTAAACTTTTATATAAAAAAAACAGTCCT

TTCTACTTTAAATCCTCGGGTACATAAACAAAAACCTGTTTCTGGTTGCGGTGTGGTTCAGCCCTTGGCATATACACCTTTAATTCAAAACAATGGAGGT

AAAGTTAGTTTGTAAAAGGAAGCACCCATGTTTGAAAGTGATGTCTAATTGAGTGGCAAGCAACAAATCAGATTTGACAGACTAGGATGTGCCCAGCTCC

CATGAGAGCAGAGAGGAGAGAGAGAGAGACTGCTTTAAGAGAGCAAGGCAGGGCGATAGGAAGGAGGAGGAGGCAGGCTACTGCTACAGAGACAGGTTGA

ACAGAGAACAAGCTAGACTCAGGGGAAGACAGAACAAGCCAGGGAGTGAGAAGGAGCCAGAAGATAAGAACACATTGCCAGAGTTAGTTTGAGGCCAAGC

AGAACAACCCAGTTAGAGGCTGAGAGAAGCCAGACTGGATCAGTCAGCTTAGAAAGGAGTTTGAGCCAGAACAACTGAGTTCAGAAAGAAAAAGCTTATT

CAGAGTAAGTCTCAGAGGCTGAAACAGTGTAGACCTAGATAAGATTGTGCGGAGGCTAGAAGCTTGCAGGCCTAGGGTCAACTATCAAAAGTGTGCTCTT

CTAAATTTAAATTGTTCCCCAAGATTTTCTACATT
Translation
MALRWGIVSAGLIANDFTTVLSSLPSSEHQ - UNI17188 - VVAVAARDLNRAEEFAQKFNIPKAYGSYEELAKDPNVE - UNI22907 - EVAY

IATQHPQHKPAVLLCLAAGKAVLCEKPMGVNAAEVREMVAKARSQGVFLME AIWSRFFPAMEALREVLVQGTIGDLRVARAEFGFDLSHIPRATDWNQA

GGGLLDLGIYCVQFLSMIFGAQKPEKISAVGRIHETG - UNI31433 - GVDDTVSVLLQYPGGVHGSFTCSISSNLPNTAYVSGTKGMAQ - UNI3

0801 - - UNI31433 - IQKLWAPTELVVNGERKEFPPPVLGKDYNFVNGSCMLYEANHVRECLRKG - UNI30801 - - UNI31433 - GLK

ESPVVPLAESELLAEILEEARKAIGVTFPQDKR

For any suggestions or comments, please send an email to unitrap@crg.es