Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011831 (Evi5)
Chromosomal location
Chr 5: 108173814 - 108304126 (-)
Description
ecotropic viral integration site 5 Gene [Source:MGI (curated);Acc:Evi5-001]
RefSeq_dna
NM_007964 
RefSeq_peptide
NP_031990.2 
UniGene
Mm.411115 Mm.35796 
MGI
MGI:104736 
Uniprot/SWISSPROT
P97366 
Uniprot/SPTREMBL
Q05C24 Q3TMK4 Q3TNX9 Q3TRC2 Q3UYX4 
Human Ortholog
ENSG00000067208 (EVI5)
Omim not available
UniTrap UNI11573
Vector Insertion
Chr 5: 108304007 - 108304127
Public Clones P066E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27871
Vector Insertion
Chr 5: 108271320 - 108304007
Public Clones (sanger) IST14330B3 (tigm) IST13153F11 (tigm) IST11537C6 (tigm) IST14761G1 (tigm)
IST13201H7 (tigm) IST14275C4 (tigm) IST12895F6 (tigm) IST14240F2 (tigm)
IST14629D12 (tigm)
Private Clones OST45415 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19190
Vector Insertion
Chr 5: 108250914 - 108271089
Public Clones (sanger)
Private Clones OST402410 (lexicon) OST258616 (lexicon) OST211311 (lexicon) OST188238 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23737
Vector Insertion
Chr 5: 108249676 - 108250723
Public Clones not available
Private Clones OST246403 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28268
Vector Insertion
Chr 5: 108244911 - 108245792
Public Clones not available
Private Clones OST35687 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7843
Vector Insertion
Chr 5: 108224717 - 108224877
Public Clones RRP067 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2907
Vector Insertion
Chr 5: 108193791 - 108217217
Public Clones AD0594 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2669
Vector Insertion
Chr 5: 108177477 - 108193694
Public Clones AL0552 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000011975
Sequence
AAACACTCCCTATGAGTCAGCTGTAAATTCAATTCAAATCCCCAGTCTCCTAGTCTCCTCCTCTCATCATGGTTACCACCAAAATGACTGCTGCCTTTAG

AAACCCTAATAGGAGACAG - UNI11573 - - UNI27871 - GTGGCGACAGACAAGGTGGCAGAAAAGCTGAGTTCTACTCTCTCATGGGTGAAG

AACACAGTATCGCATACAGTCAGTCAGATGGCCAGTCAGGTGGCAAGTCCATCTGCCTCACTACACACTACATCCTCATCTACCACACTGTCAACACCAA

CACAGTCACCATCTTCCCCATCAAAGTTGAGTCCAGACGACTTAGAACTCCTGGCTAAGCTGGAGGAACAAAACAG - UNI19190 - ATTAATAGAG

ACAGACAGTAAGTCTTTAAGATCAGTGAATGGGTCAAGAAGAAACAGTGGTTCCTCTCTTGTATCAAGTTCATCAGCCTCCAGCAACCTCAGCCACCTGG

AGGAAGACTCTTGGATTCTCTGGGGAAGAATTGTGAATGAATGGGATGATGTACGCAAGAAGAAAGAAAAGCAAGTGAAG - UNI23737 - GAGCTT

GTTCGTAAAGGGATACCCCATCACTTCAGAGCAATAGTGTGGCAACTTTTATGTAATGCACAGAGTATGACAATTAAGGACCAGTATTCAGAACTCCTGA

AAATGACTTCACCTTGTGAAAAACTGATACGAAGGGACATTGCTAGAACTTATCCAGAACACAACTTTTTTAAGGAAAAAGATAGCCTTGGACAGGAGGT

TTTATTTAATGTAATGAAG GCATACTCCTTAGTGGACCGTGAGGTTGGTTACTGTCAGGGCAGTGCTTTCATCGTTGGATTGTTGCTGATGCAG ATGC

CAGAAGAAGAGGCTTTTTGTGTATTTGTTAAATTAATGCAAGACTACAGACTTCGTGAACTATTTAAGCCAAGTATGGCGGAATTGGGCCTTTGTATGTA

CCAGTTTGAATGTATGATACAG GAGTATCTTCCGGAACTCTTTGTACATTTTCAATCTCAGAGTTTTCATACGTCAATGTATGCATCATCCTGGTTCCT

GACAATCTTTCTTACAACTTTCCCACTACCAATTGCGACAAGGATATTTGACATCTTTATGTCTGAG - UNI28268 - GGTTTGGAAATAGTGTTTC

GAGTAGGATTAGCGCTTCTTCAGATGAATCAGGCAGAATTAATGCAACTTGACATGGAAGGGATGTTACAG CACTTTCAGAAGGTCATTCCACATCAGT

TTGATGGTGGCCCAGAAAAATTAATCCAGTCAGCTTACCAAGTCAAATACAACTCAAAAAAAATGAAAAA ACTTGAAAAAGAATACACTACAATAAAAA

CTAAAGAAATGGAAGAACAAGGTGAAATTAAA AGGCTACGCACAGAAAATAGGCTTTTAAAACAGCGCATTGAAACATTAGAAAAA GAAAGTGCTTCC

TTGGCAGATAGATTGATACAG GGACAAGTGACCAGAGCCCAGGAGGCTGAGGAAAACTACCTCATAAAACGGGAGTTGGCCACCATCAAACAACAGACT

GATGCGGCCAGGGCTAAGCTGGAGCAGGCTGAAAGCACCATCAGGGAGCTCCGGCACCACCGCCACTGG CATAAATGCAGTTCCACCTACAACGAAGAT

TTCGTGCTGCAGCTGGAGAAGGAATTGGTTCAAGCCAGACTGAGTGAAGCCGAGTCTCAGTGTGCACTGAAGGAGATGCAGGATAAAGTGTTGGATATAG

AGAAG AAGAACAACTCATTTCCTGATGAGAATAATATTGCAAGGCTTCAGGAGGAACTCATCGCTGTGAAGCTGAGGGAAGCCGAAGCCATTATGGGTT

TGAAAGAACTTCGACAGCAAGTCAGAACCTTAGAAGAGCACTGGCAG - UNI7843 - CGTCACTTAGCTCGAACTTCTGGAAGATGGAAAGACCCAC

CCAAGAAAAATGCTGTGAATGAGTTACAGGATGAGCTGATGAGCATTCGCCTTAGAGAGGCGGAAACACAGGCAGAAATAAGAGAGATGAAGCAAAGGAT

GATGGAAATGGAGACACAG - UNI7843 - AACCAGATCAATAGTAACCAACTTCGAAGAGCGGAGCAAGAGGTGAACAGTCTGCAGGAGAAGGTGTG

CTCGCTGTCTGTGAAGAACAAGGGCTTGCTTGCCCAGTTAAGTGAGGCAAAGCGCAGACAGGCAGAGATTGAATGCAAG AACAAGGAGGAAGTCATGGC

TGTGCGGCTCCGGGAAGCTGATAGCATCGCGGCCGTGGCTGAGCTGCAGCAGCACATTGCTGAGCTTGAAATCCAG - UNI2907 - AAAGAAGAGGG

CAAGCTCCAAGGACAGCTTAACAGGTCTGACTCTAACCAGTACATTAGGGAACTGAAGGACCAGATAGCAGAGCTGACTCATGAG - UNI2669 - CT

CAGATGCCTAAAAGGCCAGCGGGACTTCTCCAGCCGACCTCCTTTTGATGGAATCCACATTGTCAGCCATCTAATAGGAGACGATGAATTGTTCCACTCA

TCGGATGAAGATTTTATAGATAGTTCCTTACAGGAAAGTGCCATTGGTTTTCCTTTGCACAGAAAATCTGGCCCAATGTCTCTGAATCCTGCTTTGGCAG

ATGGCAGTGAGAGCGAAGCAGAAGACGGTATGCTGGGACCTCAGGAGAGTGACCCTGAGGCTCCACAGAAGCAGCCCCCACAGAGAGAGTCCTACTCAAC

TACCGTGTGACCGTCACTGTGACAGCCGGAGTCTTGAGGGCAGCAGTGTTACAGGAGAAGAGCTGGAGCCATCCCTTGTCCTGTACATATGTCTGTTTAC

AGTCTTACCTGACTGTCTTTGCCAAATGCTCACTGAATTTCCATTGCCACAGTAGACTGAAGTATGCTAATTGGTAAATGGGGTTCTAACAGTATTACTG

AATATAAATTTTTCCTATTTAGAAAATACTGCTATGTCTAAATGTGAGAATTGTTTAAAAATTGAGGACTATGGGAAATTGGATTCTTTTTAAACAAAAC

TGCTCTTGTGCAATATTTTATGCTCATTGAACAAACTGTACATTTGTGTTTATTAGTTTCCAAGTCAGCTGCCTGTAGACGTGTGACCAGCACAGAGATG

TGATTTATCCTGTGCTTGGCATGTCTGTTTCTTCACTAAAATTCAGTTCTGTTAGTGGCCATTGGAGACTGTCACACAAACACCTTTTCTTTGTATAATT

TCTAAACACAAAGTAATTGTCTGTTCTGAAAGTTTTTTGTTTTAGTTTCTAAGTTTTATGTGTATTATATTTCTGTGTGTTAGTCAGAATAGTAGCAGGT

TAGCTACAGATATATTATTTGTACATATTTATAAATCTACCACCCAACACCTCTTACTTACATGAGTAGCAAACATTGACTAGGACTGCCTTCAGCATTC

CAACAGAACTTGTGTAAAATAACAGGTTAAAAGACAACTCAATACAGATCAGACACTACTGGCTTAGCAGCTGTAGTAACTTGCAGATTCATAACTGATT

GCTGTCCAAACACTACTGATGAAGCCCTTTACTCCATCTGTAACTAATAATATAAGTTCCACGATTAAAGAGGTTATAGCACATGCTACTTCTTGCTAAT

CTATTTAATATAATTTAGCACTAGAATAAAGTCCAAGATGCACACAAATATATCTGAAAAGAATGTTGTGAGTATTGTATTAAATCCTTCAGCTTCTAAC

CGACAGGTAAAGCCATAAAAACCCTTTACTCAGTTGTTTCCTTGTGTTCAGACTTTTTCTCTAGAAAGCCGAGTGCCTGTTAGTTGTGAATTGAGAAAGG

ACACTCAACCTGTGGAGAGGCGGCAGGCTGCTGCTGACTGGATGCCTCCACACTCTTTTGTTAGCAGCCTAGGAAAAGAAGAGCCATAGTGGGAAATAGA

ACTTAGTACATTTATGGAATTACATTCTTAGACAGAATGTTTTATACATGAAGAAAAATGTTTTATGAAATGGAGTAGAAGAAGCAAAAGTAGTTTTCAT

TCTATGACTGTGTGATGCCTTATGCTGCATTGTGGGCTGGGCTGTCCCAGGGAGACTGTGCCCAAGCTACTCTCTTGCTTGACAGACAAGATTGGAAATG

CCTTCTGTGTCCAGAGCACCCGCTAAATTCTTGTATTTAATTTACCTGTGATCACAAGCTAGTTATTTGAGGTATTAATTAAATCTTCTCAAAAGGCCTC

ACTAATGAGCTTTTTAGCTCCCTGCTCTCTGGCAATACAATAAGTCTTATTTAAATATGTCTGCAGAGACTCTTCTGTAGAGATGGAAATTCACGAGCAT

GGAGTCAAGTCTCTCAGTGAGAGTGGGTCCTGCTCTGAGAGTGACAGCACTGCCAGGGTCGAGTCCCTTCGGGTTCTCCTGTGTGGCTCTGTACTCTTAG

TTCAGGAGGTTGTCGTAGCCCAGCAAAGTGAGATGACTTGTATCTCTGTTCTTTATCTCGATTCCACATTAGGAAACATGAATGGGGCTAGCAGTACAGC

TCGAAAGTTAGAATGCTTACTTAAAATGCCCATGGCCCTGTGTCCAATCCCAGAACCACCAAAAGACAAACAAAGACAGAGAACAACCTAATACTCTTTC

TGGTTTGAAATAGGTGTAAAATAACCTTGGTAATTAGATTTTAATTCATTGATGCTCTTTTGGTTTGTACAGGGGAAAGCTAGAAGCGTTTAGGTTTTTG

AGTCAAGTCAGGTGCAGGGGGGCATGCCTACATCAGCTACTCTGGAAGCTGAGGCAGGAAGACTGCTTGAGTACAAGACCAGCCTGGGTAATATCAAAAA

AATATTTTTTAAAATTTACATGCACCTGAGAGAAATATAAAATCTTTATGGATATCAGGGTCCTATAGGATACTATGCTCTGATCTGACTCCATTTCACT

CAAACTAATATTAAGAATCTGTTTAGGACTTTAAGGTGTTGGACTGTGGTCTAATGATGAATTTTTACTTCATCTGATATTTTTGTGTTTTTCAAATGGT

ATCTATTCACACCCTAAGACTTGAAGGATGTTCTAGGCAGAAAATGAGTGGATGACAGAGGACAGAAAACTTTGCTGTCTTGGGATAGTGACTTTCCTTC

TCTTGTTTCTGCCCAGGTGACACACTAAAGGAGAGCCCAGACATTAGGATCCAAAAAGCAGTTCAACAAACTTTTTTTTTCAGTACTGGGGGTGGAACCC

AGGGCCTTACACAGTGGGTAAGCTCTCTACTGCTGTGCCACACCCAGAGTCTGACTTCTTTAAAATCAATGCATAAATTTTTTTATGGAGAACGAGGCCA

AAGAGATTGTTTTATCAACTTCTACTCTGGTTTCTTGCTGTTTGAATTTTTTGTTTTGGTTTGTTTTTATTTTGCTTGACCAGTTGTCAGCCAGTCAGCC

TTTGCTGGTTGATGGAAACATCATAGTCCAGCTAACTGGCCATTTATGTTGAGAACAAGAGAAAAAGCCTTTTCCAGCCCTGAGCACAATGCAGCTTGTG

AATTTCCAGGCAGTGCCTTTGATTGAAAATAATGTCTACTGCTTTTGAAGCATATTATTCCTGGCATCATAAGAAGTCATTTGGTTCCTTATACACCATT

TGCATAATGCACTGTAATATTCAGTTTTTAAAAGTTAAGGATATCAATTATGTTTTGGTAAGCTTTTCATGGCCAGCATGGATATTGCACAATACCAAGA

CATCGATGGCCAACATTTGTAGAATCCGTAACTTAACTTACTAAAGTAATGAGTTTTAGCTTGAAAGTTATTGCTGCTCTAGATTAGCAAACAATTTTTA

ATTAATTTCTTATTAATTCTGAAATTAATTAAAATTTCTTATTGGCAATAGGGTAGATGCTATTTAACATCCAACTTTTACATCTGTGGGTCTACATACC

CCTTCCCTCCAGAGAAGAGCTGACATGGTAATCCATTGGACATGCAAAGTTACAAGCGTATTTCATTGTCCTGCGGGGTTTTCTTCATTGTAACACTGTA

TAACCTAAAATGTCTACTTGTGCCTTTGCTTTAAATAATTAAAGTTTCTCATTTTACAAGA
Translation
 - UNI11573 - - UNI27871 - MASQVASPSASLHTTSSSTTLSTPTQSPSSPSKLSPDDLELLAKLEEQNR - UNI19190 - RLIETDSKS

LRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGRIVNEWDDVRKKKEKQVK - UNI23737 - ELVRKGIPHHFRAIVWQLLCNAQSMTIKDQY

SELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMK AYSLVDREVGYCQGSAFIVGLLLMQ MPEEEAFCVFVKLMQDYRLRELFKPSMAE

LGLCMYQFECMIQ EYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSE - UNI28268 - GLEIVFRVGLALLQMNQAELMQLD

MEGMLQ HFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKK KLEKEYTTIKTKEMEEQGEIK RLRTENRLLKQRIETLEK ESASLADRLIQ GQVTRA

QEAEENYLIKRELATIKQQTDAARAKLEQAESTIRELRHHRHW HKCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEK KNNSFPDENN

IARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQ - UNI7843 - RHLARTSGRWKDPPKKNAVNELQDELMSIRLREAETQAEIREMK - UNI

7843 -   - UNI2907 -  - UNI2669 - 
Transcript ENSMUST00000100947
Sequence
AAACACTCCCTATGAGTCAGCTGTAAATTCAATTCAAATCCCCAGTCTCCTAGTCTCCTCCTCTCATCATGGTTACCACCAAAATGACTGCTGCCTTTAG

AAACCCTAATAGGAGACAG - UNI11573 - - UNI27871 - GTGGCGACAGACAAGGTGGCAGAAAAGCTGAGTTCTACTCTCTCATGGGTGAAG

AACACAGTATCGCATACAGTCAGTCAGATGGCCAGTCAGGTGGCAAGTCCATCTGCCTCACTACACACTACATCCTCATCTACCACACTGTCAACACCAA

CACAGTCACCATCTTCCCCATCAAAGTTGAGTCCAGACGACTTAGAACTCCTGGCTAAGCTGGAGGAACAAAACAG - UNI19190 - ATTAATAGAG

ACAGACAGTAAGTCTTTAAGATCAGTGAATGGGTCAAGAAGAAACAGTGGTTCCTCTCTTGTATCAAGTTCATCAGCCTCCAGCAACCTCAGCCACCTGG

AGGAAGACTCTTGGATTCTCTGGGGAAGAATTGTGAATGAATGGGATGATGTACGCAAGAAGAAAGAAAAGCAAGTGAAG - UNI23737 - GAGCTT

GTTCGTAAAGGGATACCCCATCACTTCAGAGCAATAGTGTGGCAACTTTTATGTAATGCACAGAGTATGACAATTAAGGACCAGTATTCAGAACTCCTGA

AAATGACTTCACCTTGTGAAAAACTGATACGAAGGGACATTGCTAGAACTTATCCAGAACACAACTTTTTTAAGGAAAAAGATAGCCTTGGACAGGAGGT

TTTATTTAATGTAATGAAG GCATACTCCTTAGTGGACCGTGAG GTTACTGTCAGGGCAGTGCTTTCATCGTTGGATTGTTGC ATGCAG ATGCCAGA

AGAAGAGGCTTTTTGTGTATTTGTTAAATTAATGCAAGACTACAGACTTCGTGAACTATTTAAGCCAAGTATGGCGGAATTGGGCCTTTGTATGTACCAG

TTTGAATGTATGATACAG GAGTATCTTCCGGAACTCTTTGTACATTTTCAATCTCAGAGTTTTCATACGTCAATGTATGCATCATCCTGGTTCCTGACA

ATCTTTCTTACAACTTTCCCACTACCAATTGCGACAAGGATATTTGACATCTTTATGTCTGAG - UNI28268 - GGTTTGGAAATAGTGTTTCGAGT

AGGATTAGCGCTTCTTCAGATGAATCAGGCAGAATTAATGCAACTTGACATGGAAGGGATGTTACAG CACTTTCAGAAGGTCATTCCACATCAGTTTGA

TGGTGGCCCAGAAAAATTAATCCAGTCAGCTTACCAAGTCAAATACAACTCAAAAAAAATGAAAAA ACTTGAAAAAGAATACACTACAATAAAAACTAA

AGAAATGGAAGAACAAGGTGAAATTAAA AGGCTACGCACAGAAAATAGGCTTTTAAAACAGCGCATTGAAACATTAGAAAAA CATAAATGCAGTTCCA

CCTACAACGAAGATTTCGTGCTGCAGCTGGAGAAGGAATTGGTTCAAGCCAGACTGAGTGAAGCCGAGTCTCAGTGTGCACTGAAGGAGATGCAGGATAA

AGTGTTGGATATAGAGAAG AAGAACAACTCATTTCCTGATGAGAATAATATTGCAAGGCTTCAGGAGGAACTCATCGCTGTGAAGCTGAGGGAAGCCGA

AGCCATTATGGGTTTGAAAGAACTTCGACAGCAAGTCAGAACCTTAGAAGAGCACTGGCAG - UNI7843 - CGTCACTTAGCTCGAACTTCTGGAAG

ATGGAAAGACCCACCCAAGAAAAATGCTGTGAATGAGTTACAGGATGAGCTGATGAGCATTCGCCTTAGAGAGGCGGAAACACAGGCAGAAATAAGAGAG

ATGAAGCAAAGGATGATGGAAATGGAGACACAG - UNI7843 - AACCAGATCAATAGTAACCAACTTCGAAGAGCGGAGCAAGAGGTGAACAGTCTG

CAGGAGAAGGTGTGCTCGCTGTCTGTGAAGAACAAGGGCTTGCTTGCCCAGTTAAGTGAGGCAAAGCGCAGACAGGCAGAGATTGAATGCAAG AACAAG

GAGGAAGTCATGGCTGTGCGGCTCCGGGAAGCTGATAGCATCGCGGCCGTGGCTGAGCTGCAGCAGCACATTGCTGAGCTTGAAATCCAG - UNI2907

 - AAAGAAGAGGGCAAGCTCCAAGGACAGCTTAACAGGTCTGACTCTAACCAGTACATTAGGGAACTGAAGGACCAGATAGCAGAGCTGACTCATGAG 

- UNI2669 - CTCAGATGCCTAAAAGGCCAGCGGGACTTCTCCAGCCGACCTCCTTTTGATGGAATCCACATTGTCAGCCATCTAATAGGAGACGATG

AATTGTTCCACTCATCGGATGAAGATTTTATAGATAGTTCCTTACAGGAAAGTGCCATTGGTTTTCCTTTGCACAGAAAATCTGGCCCAATGTCTCTGAA

TCCTGCTTTGGCAGATGGCAGTGAGAGCGAAGCAGAAGACGGTATGCTGGGACCTCAGGAGAGTGACCCTGAGGCTCCACAGAAGCAGCCCCCACAGAGA

GAGTCCTACTCAACTACCGTGTGACCGTCACTGTGACAGCCGGAGTCTTGAGGGCAGCAGTGTTACAGGAGAAGAGCTGGAGCCATCCCTTGTCCTGTAC

ATATGTCTGTTTACAGTCTTACCTGACTGTCTTTGCCAAATGCTCACTGAATTTCCATTGCCACAGTAGACTGAAGTATGCTAATTGGTAAATGGGGTTC

TAACAGTATTACTGAATATAAATTTTTCCTATTTAGAAAATACTGCTATGTCTAAATGTGAGAATTGTTTAAAAATTGAGGACTATGGGAAATTGGATTC

TTTTTAAACAAAACTGCTCTTGTGCAATATTTTATGCTCATTGAACAAACTGTACATTTGTGTTTATTAGTTTCCAAGTCAGCTGCCTGTAGACGTGTGA

CCAGCACAGAGATGTGATTTATCCTGTGCTTGGCATGTCTGTTTCTTCACTAAAATTCAGTTCTGTTAGTGGCCATTGGAGACTGTCACACAAACACCTT

TTCTTTGTATAATTTCTAAACACAAAGTAATTGTCTGTTCTGAAAGTTTTTTGTTTTAGTTTCTAAGTTTTATGTGTATTATATTTCTGTGTGTTAGTCA

GAATAGTAGCAGGTTAGCTACAGATATATTATTTGTACATATTTATAAATCTACCACCCAACACCTCTTACTTACATGAGTAGCAAACATTGACTAGGAC

TGCCTTCAGCATTCCAACAGAACTTGTGTAAAATAACAGGTTAAAAGACAACTCAATACAGATCAGACACTACTGGCTTAGCAGCTGTAGTAACTTGCAG

ATTCATAACTGATTGCTGTCCAAACACTACTGATGAAGCCCTTTACTCCATCTGTAACTAATAATATAAGTTCCACGATTAAAGAGGTTATAGCACATGC

TACTTCTTGCTAATCTATTTAATATAATTTAGCACTAGAATAAAGTCCAAGATGCACACAAATATATCTGAAAAGAATGTTGTGAGTATTGTATTAAATC

CTTCAGCTTCTAACCGACAGGTAAAGCCATAAAAACCCTTTACTCAGTTGTTTCCTTGTGTTCAGACTTTTTCTCTAGAAAGCCGAGTGCCTGTTAGTTG

TGAATTGAGAAAGGACACTCAACCTGTGGAGAGGCGGCAGGCTGCTGCTGACTGGATGCCTCCACACTCTTTTGTTAGCAGCCTAGGAAAAGAAGAGCCA

TAGTGGGAAATAGAACTTAGTACATTTATGGAATTACATTCTTAGACAGAATGTTTTATACATGAAGAAAAATGTTTTATGAAATGGAGTAGAAGAAGCA

AAAGTAGTTTTCATTCTATGACTGTGTGATGCCTTATGCTGCATTGTGGGCTGGGCTGTCCCAGGGAGACTGTGCCCAAGCTACTCTCTTGCTTGACAGA

CAAGATTGGAAATGCCTTCTGTGTCCAGAGCACCCGCTAAATTCTTGTATTTAATTTACCTGTGATCACAAGCTAGTTATTTGAGGTATTAATTAAATCT

TCTCAAAAGGCCTCACTAATGAGCTTTTTAGCTCCCTGCTCTCTGGCAATACAATAAGTCTTATTTAAATATGTCTGCAGAGACTCTTCTGTAGAGATGG

AAATTCACGAGCATGGAGTCAAGTCTCTCAGTGAGAGTGGGTCCTGCTCTGAGAGTGACAGCACTGCCAGGGTCGAGTCCCTTCGGGTTCTCCTGTGTGG

CTCTGTACTCTTAGTTCAGGAGGTTGTCGTAGCCCAGCAAAGTGAGATGACTTGTATCTCTGTTCTTTATCTCGATTCCACATTAGGAAACATGAATGGG

GCTAGCAGTACAGCTCGAAAGTTAGAATGCTTACTTAAAATGCCCATGGCCCTGTGTCCAATCCCAGAACCACCAAAAGACAAACAAAGACAGAGAACAA

CCTAATACTCTTTCTGGTTTGAAATAGGTGTAAAATAACCTTGGTAATTAGATTTTAATTCATTGATGCTCTTTTGGTTTGTACAGGGGAAAGCTAGAAG

CGTTTAGGTTTTTGAGTCAAGTCAGGTGCAGGGGGGCATGCCTACATCAGCTACTCTGGAAGCTGAGGCAGGAAGACTGCTTGAGTACAAGACCAGCCTG

GGTAATATCAAAAAAATATTTTTTAAAATTTACATGCACCTGAGAGAAATATAAAATCTTTATGGATATCAGGGTCCTATAGGATACTATGCTCTGATCT

GACTCCATTTCACTCAAACTAATATTAAGAATCTGTTTAGGACTTTAAGGTGTTGGACTGTGGTCTAATGATGAATTTTTACTTCATCTGATATTTTTGT

GTTTTTCAAATGGTATCTATTCACACCCTAAGACTTGAAGGATGTTCTAGGCAGAAAATGAGTGGATGACAGAGGACAGAAAACTTTGCTGTCTTGGGAT

AGTGACTTTCCTTCTCTTGTTTCTGCCCAGGTGACACACTAAAGGAGAGCCCAGACATTAGGATCCAAAAAGCAGTTCAACAAACTTTTTTTTTCAGTAC

TGGGGGTGGAACCCAGGGCCTTACACAGTGGGTAAGCTCTCTACTGCTGTGCCACACCCAGAGTCTGACTTCTTTAAAATCAATGCATAAATTTTTTTAT

GGAGAACGAGGCCAAAGAGATTGTTTTATCAACTTCTACTCTGGTTTCTTGCTGTTTGAATTTTTTGTTTTGGTTTGTTTTTATTTTGCTTGACCAGTTG

TCAGCCAGTCAGCCTTTGCTGGTTGATGGAAACATCATAGTCCAGCTAACTGGCCATTTATGTTGAGAACAAGAGAAAAAGCCTTTTCCAGCCCTGAGCA

CAATGCAGCTTGTGAATTTCCAGGCAGTGCCTTTGATTGAAAATAATGTCTACTGCTTTTGAAGCATATTATTCCTGGCATCATAAGAAGTCATTTGGTT

CCTTATACACCATTTGCATAATGCACTGTAATATTCAGTTTTTAAAAGTTAAGGATATCAATTATGTTTTGGTAAGCTTTTCATGGCCAGCATGGATATT

GCACAATACCAAGACATCGATGGCCAACATTTGTAGAATCCGTAACTTAACTTACTAAAGTAATGAGTTTTAGCTTGAAAGTTATTGCTGCTCTAGATTA

GCAAACAATTTTTAATTAATTTCTTATTAATTCTGAAATTAATTAAAATTTCTTATTGGCAATAGGGTAGATGCTATTTAACATCCAACTTTTACATCTG

TGGGTCTACATACCCCTTCCCTCCAGAGAAGAGCTGACATGGTAATCCATTGGACATGCAAAGTTACAAGCGTATTTCATTGTCCTGCGGGGTTTTCTTC

ATTGTAACACTGTATAACCTAAAATGTCTACTTGTGCCTTTGCTTTAAATAATTAAAGTTTCTCATTTTACAAGA
Translation
MTAAFRNPNRRQ - UNI11573 - - UNI27871 - VATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSASLHTTSSSTTLSTPTQSPSSPSKL

SPDDLELLAKLEEQNR - UNI19190 - RLIETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGRIVNEWDDVRKKKEKQVK - UNI

23737 - ELVRKGIPHHFRAIVWQLLCNAQSMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMK AYSLVDRE VTVRAVL

SSLDCC MQ MPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQ EYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMS

E - UNI28268 - GLEIVFRVGLALLQMNQAELMQLDMEGMLQ HFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKK KLEKEYTTIKTKEMEEQGEI

K RLRTENRLLKQRIETLEK HKCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEK KNNSFPDENNIARLQEELIAVKLREAEAIMGLK

ELRQQVRTLEEHWQ - UNI7843 - RHLARTSGRWKDPPKKNAVNELQDELMSIRLREAETQAEIREMKQRMMEMETQ - UNI7843 - NQINSNQ

LRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECK NKEEVMAVRLREADSIAAVAELQQHIAELEIQ - UNI2907 - KEEGKLQGQLNR

SDSNQYIRELKDQIAELTHE - UNI2669 - LRCLKGQRDFSSRPPFDGIHIVSHLIGDDELFHSSDEDFIDSSLQESAIGFPLHRKSGPMSLNPALA

DGSESEAEDGMLGPQESDPEAPQKQPPQRESYSTTV
Transcript ENSMUST00000112642
Sequence
AAACACTCCCTATGAGTCAGCTGTAAATTCAATTCAAATCCCCAGTCTCCTAGTCTCCTCCTCTCATCATGGTTACCACCAAAATGACTGCTGCCTTTAG

AAACCCTAATAGGAGACAG - UNI11573 - - UNI27871 - GTGGCGACAGACAAGGTGGCAGAAAAGCTGAGTTCTACTCTCTCATGGGTGAAG

AACACAGTATCGCATACAGTCAGTCAGATGGCCAGTCAGGTGGCAAGTCCATCTGCCTCACTACACACTACATCCTCATCTACCACACTGTCAACACCAA

CACAGTCACCATCTTCCCCATCAAAGTTGAGTCCAGACGACTTAGAACTCCTGGCTAAGCTGGAGGAACAAAACAG - UNI19190 - ATTAATAGAG

ACAGACAGTAAGTCTTTAAGATCAGTGAATGGGTCAAGAAGAAACAGTGGTTCCTCTCTTGTATCAAGTTCATCAGCCTCCAGCAACCTCAGCCACCTGG

AGGAAGACTCTTGGATTCTCTGGGGAAGAATTGTGAATGAATGGGATGATGTACGCAAGAAGAAAGAAAAGCAAGTGAAG - UNI23737 - GAGCTT

GTTCGTAAAGGGATACCCCATCACTTCAGAGCAATAGTGTGGCAACTTTTATGTAATGCACAGAGTATGACAATTAAGGACCAGTATTCAGAACTCCTGA

AAATGACTTCACCTTGTGAAAAACTGATACGAAGGGACATTGCTAGAACTTATCCAGAACACAACTTTTTTAAGGAAAAAGATAGCCTTGGACAGGAGGT

TTTATTTAATGTAATGAAG GCATACTCCTTAGTGGACCGTGAGGTTGGTTACTGTCAGGGCAGTGCTTTCATCGTTGGATTGTTGCTGATGCAG ATGC

CAGAAGAAGAGGCTTTTTGTGTATTTGTTAAATTAATGCAAGACTACAGACTTCGTGAACTATTTAAGCCAAGTATGGCGGAATTGGGCCTTTGTATGTA

CCAGTTTGAATGTATGATACAG GAGTATCTTCCGGAACTCTTTGTACATTTTCAATCTCAGAGTTTTCATACGTCAATGTATGCATCATCCTGGTTCCT

GACAATCTTTCTTACAACTTTCCCACTACCAATTGCGACAAGGATATTTGACATCTTTATGTCTGAG - UNI28268 - GGTTTGGAAATAGTGTTTC

GAGTAGGATTAGCGCTTCTTCAGATGAATCAGGCAGAATTAATGCAACTTGACATGGAAGGGATGTTACAG CACTTTCAGAAGGTCATTCCACATCAGT

TTGATGGTGGCCCAGAAAAATTAATCCAGTCAGCTTACCAAGTCAAATACAACTCAAAAAAAATGAAAAA ACTTGAAAAAGAATACACTACAATAAAAA

CTAAAGAAATGGAAGAACAAGGTGAAATTAAA AGGCTACGCACAGAAAATAGGCTTTTAAAACAGCGCATTGAAACATTAGAAAAA CATAAATGCAGT

TCCACCTACAACGAAGATTTCGTGCTGCAGCTGGAGAAGGAATTGGTTCAAGCCAGACTGAGTGAAGCCGAGTCTCAGTGTGCACTGAAGGAGATGCAGG

ATAAAGTGTTGGATATAGAGAAG AAGAACAACTCATTTCCTGATGAGAATAATATTGCAAGGCTTCAGGAGGAACTCATCGCTGTGAAGCTGAGGGAAG

CCGAAGCCATTATGGGTTTGAAAGAACTTCGACAGCAAGTCAGAACCTTAGAAGAGCACTGGCAG - UNI7843 - CGTCACTTAGCTCGAACTTCTG

GAAGATGGAAAGACCCACCCAAGAAAAATGCTGTGAATGAGTTACAGGATGAGCTGATGAGCATTCGCCTTAGAGAGGCGGAAACACAGGCAGAAATAAG

AGAGATGAAGCAAAGGATGATGGAAATGGAGACACAG - UNI7843 - AACCAGATCAATAGTAACCAACTTCGAAGAGCGGAGCAAGAGGTGAACAG

TCTGCAGGAGAAGGTGTGCTCGCTGTCTGTGAAGAACAAGGGCTTGCTTGCCCAGTTAAGTGAGGCAAAGCGCAGACAGGCAGAGATTGAATGCAAG AA

CAAGGAGGAAGTCATGGCTGTGCGGCTCCGGGAAGCTGATAGCATCGCGGCCGTGGCTGAGCTGCAGCAGCACATTGCTGAGCTTGAAATCCAG - UNI

2907 - AAAGAAGAGGGCAAGCTCCAAGGACAGCTTAACAGGTCTGACTCTAACCAGTACATTAGGGAACTGAAGGACCAGATAGCAGAGCTGACTCAT

GAG - UNI2669 - CTCAGATGCCTAAAAGGCCAGCGGGACTTCTCCAGCCGACCTCCTTTTGATGGAATCCACATTGTCAGCCATCTAATAGGAGAC

GATGAATTGTTCCACTCATCGGATGAAGATTTTATAGATAGTTCCTTACAGGAAAGTGCCATTGGTTTTCCTTTGCACAGAAAATCTGGCCCAATGTCTC

TGAATCCTGCTTTGGCAGATGGCAGTGAGAGCGAAGCAGAAGACGGTATGCTGGGACCTCAGGAGAGTGACCCTGAGGCTCCACAGAAGCAGCCCCCACA

GAGAGAGTCCTACTCAACTACCGTGTGACCGTCACTGTGACAGCCGGAGTCTTGAGGGCAGCAGTGTTACAGGAGAAGAGCTGGAGCCATCCCTTGTCCT

GTACATATGTCTGTTTACAGTCTTACCTGACTGTCTTTGCCAAATGCTCACTGAATTTCCATTGCCACAGTAGACTGAAGTATGCTAATTGGTAAATGGG

GTTCTAACAGTATTACTGAATATAAATTTTTCCTATTTAGAAAATACTGCTATGTCTAAATGTGAGAATTGTTTAAAAATTGAGGACTATGGGAAATTGG

ATTCTTTTTAAACAAAACTGCTCTTGTGCAATATTTTATGCTCATTGAACAAACTGTACATTTGTGTTTATTAGTTTCCAAGTCAGCTGCCTGTAGACGT

GTGACCAGCACAGAGATGTGATTTATCCTGTGCTTGGCATGTCTGTTTCTTCACTAAAATTCAGTTCTGTTAGTGGCCATTGGAGACTGTCACACAAACA

CCTTTTCTTTGTATAATTTCTAAACACAAAGTAATTGTCTGTTCTGAAAGTTTTTTGTTTTAGTTTCTAAGTTTTATGTGTATTATATTTCTGTGTGTTA

GTCAGAATAGTAGCAGGTTAGCTACAGATATATTATTTGTACATATTTATAAATCTACCACCCAACACCTCTTACTTACATGAGTAGCAAACATTGACTA

GGACTGCCTTCAGCATTCCAACAGAACTTGTGTAAAATAACAGGTTAAAAGACAACTCAATACAGATCAGACACTACTGGCTTAGCAGCTGTAGTAACTT

GCAGATTCATAACTGATTGCTGTCCAAACACTACTGATGAAGCCCTTTACTCCATCTGTAACTAATAATATAAGTTCCACGATTAAAGAGGTTATAGCAC

ATGCTACTTCTTGCTAATCTATTTAATATAATTTAGCACTAGAATAAAGTCCAAGATGCACACAAATATATCTGAAAAGAATGTTGTGAGTATTGTATTA

AATCCTTCAGCTTCTAACCGACAGGTAAAGCCATAAAAACCCTTTACTCAGTTGTTTCCTTGTGTTCAGACTTTTTCTCTAGAAAGCCGAGTGCCTGTTA

GTTGTGAATTGAGAAAGGACACTCAACCTGTGGAGAGGCGGCAGGCTGCTGCTGACTGGATGCCTCCACACTCTTTTGTTAGCAGCCTAGGAAAAGAAGA

GCCATAGTGGGAAATAGAACTTAGTACATTTATGGAATTACATTCTTAGACAGAATGTTTTATACATGAAGAAAAATGTTTTATGAAATGGAGTAGAAGA

AGCAAAAGTAGTTTTCATTCTATGACTGTGTGATGCCTTATGCTGCATTGTGGGCTGGGCTGTCCCAGGGAGACTGTGCCCAAGCTACTCTCTTGCTTGA

CAGACAAGATTGGAAATGCCTTCTGTGTCCAGAGCACCCGCTAAATTCTTGTATTTAATTTACCTGTGATCACAAGCTAGTTATTTGAGGTATTAATTAA

ATCTTCTCAAAAGGCCTCACTAATGAGCTTTTTAGCTCCCTGCTCTCTGGCAATACAATAAGTCTTATTTAAATATGTCTGCAGAGACTCTTCTGTAGAG

ATGGAAATTCACGAGCATGGAGTCAAGTCTCTCAGTGAGAGTGGGTCCTGCTCTGAGAGTGACAGCACTGCCAGGGTCGAGTCCCTTCGGGTTCTCCTGT

GTGGCTCTGTACTCTTAGTTCAGGAGGTTGTCGTAGCCCAGCAAAGTGAGATGACTTGTATCTCTGTTCTTTATCTCGATTCCACATTAGGAAACATGAA

TGGGGCTAGCAGTACAGCTCGAAAGTTAGAATGCTTACTTAAAATGCCCATGGCCCTGTGTCCAATCCCAGAACCACCAAAAGACAAACAAAGACAGAGA

ACAACCTAATACTCTTTCTGGTTTGAAATAGGTGTAAAATAACCTTGGTAATTAGATTTTAATTCATTGATGCTCTTTTGGTTTGTACAGGGGAAAGCTA

GAAGCGTTTAGGTTTTTGAGTCAAGTCAGGTGCAGGGGGGCATGCCTACATCAGCTACTCTGGAAGCTGAGGCAGGAAGACTGCTTGAGTACAAGACCAG

CCTGGGTAATATCAAAAAAATATTTTTTAAAATTTACATGCACCTGAGAGAAATATAAAATCTTTATGGATATCAGGGTCCTATAGGATACTATGCTCTG

ATCTGACTCCATTTCACTCAAACTAATATTAAGAATCTGTTTAGGACTTTAAGGTGTTGGACTGTGGTCTAATGATGAATTTTTACTTCATCTGATATTT

TTGTGTTTTTCAAATGGTATCTATTCACACCCTAAGACTTGAAGGATGTTCTAGGCAGAAAATGAGTGGATGACAGAGGACAGAAAACTTTGCTGTCTTG

GGATAGTGACTTTCCTTCTCTTGTTTCTGCCCAGGTGACACACTAAAGGAGAGCCCAGACATTAGGATCCAAAAAGCAGTTCAACAAACTTTTTTTTTCA

GTACTGGGGGTGGAACCCAGGGCCTTACACAGTGGGTAAGCTCTCTACTGCTGTGCCACACCCAGAGTCTGACTTCTTTAAAATCAATGCATAAATTTTT

TTATGGAGAACGAGGCCAAAGAGATTGTTTTATCAACTTCTACTCTGGTTTCTTGCTGTTTGAATTTTTTGTTTTGGTTTGTTTTTATTTTGCTTGACCA

GTTGTCAGCCAGTCAGCCTTTGCTGGTTGATGGAAACATCATAGTCCAGCTAACTGGCCATTTATGTTGAGAACAAGAGAAAAAGCCTTTTCCAGCCCTG

AGCACAATGCAGCTTGTGAATTTCCAGGCAGTGCCTTTGATTGAAAATAATGTCTACTGCTTTTGAAGCATATTATTCCTGGCATCATAAGAAGTCATTT

GGTTCCTTATACACCATTTGCATAATGCACTGTAATATTCAGTTTTTAAAAGTTAAGGATATCAATTATGTTTTGGTAAGCTTTTCATGGCCAGCATGGA

TATTGCACAATACCAAGACATCGATGGCCAACATTTGTAGAATCCGTAACTTAACTTACTAAAGTAATGAGTTTTAGCTTGAAAGTTATTGCTGCTCTAG

ATTAGCAAACAATTTTTAATTAATTTCTTATTAATTCTGAAATTAATTAAAATTTCTTATTGGCAATAGGGTAGATGCTATTTAACATCCAACTTTTACA

TCTGTGGGTCTACATACCCCTTCCCTCCAGAGAAGAGCTGACATGGTAATCCATTGGACATGCAAAGTTACAAGCGTATTTCATTGTCCTGCGGGGTTTT

CTTCATTGTAACACTGTATAACCTAAAATGTCTACTTGTGCCTTTGCTTTAAATAATTAAAGTTTCTCATTTTACAAGA
Translation
MVTTKMTAAFRNPNRRQ - UNI11573 - - UNI27871 - VATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSASLHTTSSSTTLSTPTQSPS

SPSKLSPDDLELLAKLEEQNR - UNI19190 - RLIETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGRIVNEWDDVRKKKEKQVK 

- UNI23737 - ELVRKGIPHHFRAIVWQLLCNAQSMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMK AYSLVDREVGY

CQGSAFIVGLLLMQ MPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQ EYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIF

DIFMSE - UNI28268 - GLEIVFRVGLALLQMNQAELMQLDMEGMLQ HFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKK KLEKEYTTIKTKEME

EQGEIK RLRTENRLLKQRIETLEK HKCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEK KNNSFPDENNIARLQEELIAVKLREAEA

IMGLKELRQQVRTLEEHWQ - UNI7843 - RHLARTSGRWKDPPKKNAVNELQDELMSIRLREAETQAEIREMKQRMMEMETQ - UNI7843 - NQ

INSNQLRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECK NKEEVMAVRLREADSIAAVAELQQHIAELEIQ - UNI2907 - KEEGKLQ

GQLNRSDSNQYIRELKDQIAELTHE - UNI2669 - LRCLKGQRDFSSRPPFDGIHIVSHLIGDDELFHSSDEDFIDSSLQESAIGFPLHRKSGPMSL

NPALADGSESEAEDGMLGPQESDPEAPQKQPPQRESYSTTV

For any suggestions or comments, please send an email to unitrap@crg.es