Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011884 (Gltp)
Chromosomal location
Chr 5: 115119415 - 115140950 (-)
Description
glycolipid transfer protein Gene [Source:MGI (curated);Acc:Gltp-001]
RefSeq_dna
NM_019821 
RefSeq_peptide
NP_062795.2 
UniGene
Mm.275766 
MGI
MGI:1929253 
Uniprot/SWISSPROT
Q9JL62 
Uniprot/SPTREMBL
Q3U011 Q7TMS6 
Human Ortholog
ENSG00000139433 (GLTP)
Omim not available
UniTrap UNI34589
Vector Insertion
Chr 5: 115127629 - 115140918
Public Clones IST12455D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26340
Vector Insertion
Chr 5: 115126344 - 115126408
Public Clones not available
Private Clones OST124229 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17332
Vector Insertion
Chr 5: 115124214 - 115126273
Public Clones CMHD-GT_516H11-5S (cmhd) IST12630D10 (tigm)
Private Clones OST444991 (lexicon) OST436417 (lexicon) OST356259 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37054
Vector Insertion
Chr 5: 115124062 - 115124195
Public Clones CMHD-GT_516H11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13714
Vector Insertion
Chr 5: 115120236 - 115120599
Public Clones CMHD-GT_267D6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000012028
Sequence
AGCCCGGGCGCGGACGCCCTCGGCGCGGGCTGGGGCATCACCAAGGGCCTCGACCCCGAAATGGCGCTGCTGGCCGAGCACCTGCTCAAGCCGCTGCCCG

CAGACCGGCAGATCGAGACCGGGCCCTTCCTGGAGGCTGTGGCTCACCTGCCGCCCTTCTTTG ATTGCCTTGGGTCCCCGGTATTCACGCCCATCAAGG

CAGACATAAGCGGTAACATCACC - UNI26340 - AAAATCAAAGCCGTATATGACACCGACCCAGCCAAGTTCAAGACCCTGCAGAACATCCTGGAG

GTGGAGAAGGGGATGTATGGGGCGGAGTGGCCTAAAGTGGGGGCCACTCTGGCACTGCTGTGGCTGAAAAG - UNI17332 - GGGCCTGCGCTTCAT

CCAGGTGTTCCTGCAGAGCATCTGCGATGGGGAACGCGACGAGAACCACCCCAACCTCATCCGAGTCAACGCCAACAAGGCCTATGAGATGGCCCTGAAG

AAGTACCATGGCTGGCTGGTGCAGAAGATCTTCAAG - UNI13714 - GCCGCCCTGTACGCAGCACCTTACAAGTCCGACTTCCTCAAGGCACTCTC

CAAGGGGCAGAACGTGACAGAGGAGGAGTGCCTGGAGAAGATCCGCCTCTTCCTGGTCAACTACACGGCCACCATTGACGCCATCTACGACATGTACACC

AAGATGAATGCGGAGCTTGACTACACAGTGTAGGCGCCCGGACACACAGCCCCATGTGGGCACCAGCAACCCCATCACTGTGAATCAAGCTGGAATCCCC

CAGCTCAGCCAGCCCAGCCTGGCCAGCCTGGGTCTGCAGGGGGCAGCCTTAGCTTGTTAGAGGTCTTTTGTTTTCTTGGTTTTTTGTTGTCTTGGCCTAT

TCTAATGGAGCAATAAGCACCTTCCATTCACTCCTCGGCTCCCCAAGCTCAGCCGCCACCATCCTTCCAGTGTGCTTAAAACCAATTAACGTTGCTAACT

AACGTTGCTAACGTGGAGGAATTCCTAGGGTTTTGTCATTTCCTCCCCTACCTAGCTCAGGAGGAACTCAGCTCAGGGGCGACATACACCTCACCCAGCA

AAGAAGCCCGGCCCATCTGGCCCAGGGGTGTCTTGGATGCTTGAAGGACAATGGAAGTTTGATTGGAAGTTCAGCGGGTGCCCTACTGTGGCCTCTGTTT

AAAAGGCAAGCTGGCAGGAGCCCCCCTCACGGGGCTCACACATCCATCTGGCATAACCAGCCCTGTTCTCGTTCTCTCTCTCTCTCTCCTCTCTCTCTCT

CCTCTCTGTCTCACTCTCTCTCTCTCTCTTCTCACCCCCCCTCTGTCTTTTGTCAGATAATGTTTTTTGGGTTTTTTTTTCCCCTGAAATGTACCAGCAA

GCCTTTTCAACCAACTGACTAGGCGCACACAGGTGACCCATATGTGACTGTATTTGCATTCTTCTGCATAATTATTTTCTTGGGGGTTGGCTCTTCCAAC

CTAAGAAACTGCCTCTCATAAGAGCCCTCCAGCTGCGGAGACTCAAGACACTGCCTTGCTGCCTTAACCGTCCTTCTGGAGCTGTATTTTTTAAAGTATT

GGGGTAAACCTGCCCTGAAAGAATTGATGTATGTTTAAAAAAAAAAAAAACCCAAAAAGCCCAATGAGGAACAATTGGTGATTTTTATGCAGAAACTAAA

TAATCCTTAATAAATAAATCTATATTTTGAAATC
Translation
MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFD DCLGSPVFTPIKADISGNIT - UNI26340 - KIKAVYDTDPAKFKTLQNILEVEKGMYGAE

WPKVGATLALLWLKR - UNI17332 - RGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFK - UNI13714 - AALYAA

PYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV
Transcript ENSMUST00000112214
Sequence
GGGAGGCGGCGGGCGGCGACAGCCCGGGCGCGGACGCCCTCGGCGCGGGCTGGGGCATCACCAAGGGCCTCGACCCCGAAATGGCGCTGCTGGCCGAGCA

CCTGCTCAAGCCGCTGCCCGCAGACCGGCAGATCGAGACCGGGCCCTTCCTGGAGGCTGTGGCTCACCTGCCGCCCTTCTTTG ATTGCCTTGGGTCCCC

GGTATTCACGCCCATCAAGGCAGACATAAGCGGTAACATCACC - UNI26340 - AAAATCAAAGCCGTATATGACACCGACCCAGCCAAGTTCAAGA

CCCTGCAGAACATCCTGGAG - UNI17332 - - UNI26340 - GTGTTCCTGCAGAGCATCTGCGATGGGGAACGCGACGAGAACCACCCCAACCT

CATCCGAGTCAACGCCAACAAGGCCTATGAGATGGCCCTGAAGAAGTACCATGGCTGGCTGGTGCAGAAGATCTTCAAG - UNI13714 - GCCGCCC

TGTACGCAGCACCTTACAAGTCCGACTTCCTCAAGGCACTCTCCAAGGGGCAGAACGTGACAGAGGAGGAGTGCCTGGAGAAGATCCGCCTCTTCCTGGT

CAACTACACGGCCACCATTGACGCCATCTACGACATGTACACCAAGATGAATGCGGAGCTTGACTACACAGTGTAGGCGCCCGGACACACAGCCCCATGT

GGGCACCAGCAACCCCATCACTGTGAATCAAGCTGGAATCCCCCAGCTCAGCCAGCCCAGCCTGGCCAGCCTGGGTCTGCAGGGGGCAGCCTTAGCTTGT

TAGAGGTCTTTTGTTTTCTTGGTTTTTTGTTGTCTTGGCCTATTCTAATGGAGCAATAAGCACCTTCCATTCACTCCTCGGCTCCCCAAGCTCAGCCGCC

ACCATCCTTCCAGTGTGCTTAAAACCAATTAACGTTGCTAACTAACGTTGCTAACGTGGAGGAATTCCTAGGGTTTTGTCATTTCCTCCCCTACCTAGCT

Translation
MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFD DCLGSPVFTPIKADISGNIT - UNI26340 - KIKAVYDTDPAKFKTLQNILE - UNI173

32 - - UNI26340 - VFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFK - UNI13714 - AALYAAPYKSDFLKALSKGQNVTE

EECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV
Transcript ENSMUST00000112212
Sequence
ACGCCCTCGGCGCGGGCTGGGGCATCACCAAGGGCCTCGACCCCGAAATGGCGCTGCTGGCCGAGCACCTGCTCAAGCCGCTGCCCGCAGACCGGCAGAT

CGAGACCGGGCCCTTCCTGGAGGCTGTGGCTCACCTGCCGCCCTTCTTTG ATTGCCTTGGGTCCCCGGTATTCACGCCCATCAAGGCAGACATAAGCGG

TAACATCACC - UNI26340 - AAAATCAAAGCCGTATATGACACCGACCCAGCCAAGTTCAAGACCCTGCAGAACATCCTGGAGGTGGAGAAGGGGA

T - UNI17332 - GGGCCTGCGCTTCATCCAGGTGTTCCTGCAGAGCATCTGCGATGGGGAACGCGACGAGAACCACCCCAACCTCATCCGAGTCAAC

GCCAACAAGGCCTATGAGATGGCCCTGAAGAAGTACCATGGCTGGCTGGTGCAGAAGATCTTCAAG - UNI13714 - GCCGCCCTGTACGCAGCACC

TTACAAGTCCGACTTCCTCAAGGCACTCTCCAAGGGGCAGAACGTGACAGAGGAGGAGTGCCTGGAGAAGATCCGCCTCTTCCTGGTCAACTACACGGCC

ACCATTGACGCCATCTACGACATGTACACCAAGATGAATGCGGAGCTTGACTACACAGTGTAGGCGCCCGGACACACAGCCCCATGTGGGCACCAGCAAC

CCCATCACTGTGAATCAAGCTGGAATCCCCCAGCTCAGCCAGCCCAGCCTGGCCAGCCTGGGTCTGCAGGGGGCAGCCTTAGCTTGTTAGAGGTCTTTTG

TTTTCTTGGTTTTTTGTTGTCTTGGCCTATTCTAATGGAGCA
Translation
MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFD DCLGSPVFTPIKADISGNIT - UNI26340 - KIKAVYDTDPAKFKTLQNILEVEKGM - U

NI17332 - MGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFK - UNI13714 - AALYAAPYKSDFLKALSKGQNVTEE

ECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV

For any suggestions or comments, please send an email to unitrap@crg.es