Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000011960 (Ccnt1)
Chromosomal location
Chr 15: 98373642 - 98401354 (-)
Description
cyclin T1 Gene [Source:MGI Symbol;Acc:MGI:1328363]
RefSeq_dna
NM_009833 
RefSeq_peptide
NP_033963.1 
UniGene
Mm.86538 
MGI
MGI:1328363 
Uniprot/SWISSPROT
Q9QWV9 
Uniprot/SPTREMBL
Q3V0G4 
Human Ortholog
ENSG00000129315 (CCNT1)
Omim not available
UniTrap UNI32088
Vector Insertion
Chr 15: 98397906 - 98401355
Public Clones IST13503F6 (tigm) IST12670B7 (tigm) IST14561E7 (tigm) IST14808E7 (tigm)
IST13764B9 (tigm) IST14573G11 (tigm) IST14371A1 (tigm) IST13985D12 (tigm)
IST14656D6 (tigm) IST13177A2 (tigm) IST13963D5 (tigm) IST10033F12 (tigm)
IST13388F2 (tigm) IST13830A6 (tigm) IST11526C5 (tigm) IST14340C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5573
Vector Insertion
Chr 15: 98395560 - 98397906
Public Clones YTA270 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4440
Vector Insertion
Chr 15: 98390757 - 98395477
Public Clones AC0583 (sanger) (egtc)
Private Clones OST365633 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7518
Vector Insertion
Chr 15: 98385093 - 98390627
Public Clones RRR115 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21909
Vector Insertion
Chr 15: 98377026 - 98377175
Public Clones not available
Private Clones OST314370 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25514
Vector Insertion
Chr 15: 98375040 - 98376954
Public Clones H005C06 (ggtc)
Private Clones OST180273 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000012104
Sequence
GGTTCTCCATGGAGCTGCAACTGCGTGAGCTAAATAATTCCAGGAAGCTTGAG - UNI32088 - ATGATTGGCCGCAGTGAAACGGGAGGAAAGGCT

GCTACAAAATAGGAGAGCGGTTTCCAAACGCGCCGGAGTTCTCCATGCCGGAGCTAAGAACCCAGGAACCTTTTAGTGGCTTTCGCGTTTCTGCACGGGG

CAGGGCCACTCACTGTCTCGTCCTTTCTCGGTTTTCTGAGAGTCTCGCCTATTTCCCCTGCCACTTTTTCCGTAAGCCCGGTGTTACAAAGGGGCCTCCA

TCACGCACGTCCTCGGAAACTACCCAGCCAAGCGCAGCGAGCGTTAACTAGAGGCCCGCCGGTGAGGCCCCCTTACCGCAGTTCTCGCGCGGAAAGACGA

GACCTTTAAAGAACGACGTCAGATAGTCCCGCCCACCTGGCGGTCACACGACCGGATCCTGCGTCCCGGCCGCCGGTCCGTTCTTAGCCGCGGACTGGCT

GTGGATTCGTCTACGGGGTGTCGGAGGGGTCATTCCGGAAGTCGGCGCTGGAATCTTCGGCTTTCTGGGCGGAAGTGTGTCACAACCTCGGTGGTCGCCC

CTTGGAGGAAGTTCGTCACGTCGCAGTAGTCTCGGCACGGCGGATGTGTGTCGCCGCTCCGGTGACGCTGGGAAGTGCTCGCAGCCCCCGCCGCTGCCTC

TTGGTTGAAGCACTATGGAGGGAGAGAGGAAGAACAACAACAAGCGGTGGTATTTTACTCGCGAGCAGCTGGAGAACAGCCCGTCGCGTCGCTTTGGCGT

GGACTCCGATAAAGAACTCTCTTACCGCCAGCAGGCGGCCAATCTCCTCCAGGACATGGGACAACGTCTGAACGT - UNI5573 - - UNI32088 -

 CTCACAACTGACGATCAATACTGCTATAGTATACATGCACCGATTCTACATGATTCAGTCTTTTACACAGTTTCATCGATAT - UNI4440 - TCCA

TGGCTCCAGCAGCCTTGTTTCTAGCAGCAAAAGTAGAAGAACAACCAAAGAAATTGGAGCATGTCATCAAGGTGGCACACACTTGCCTGCACCCACAGGA

GTCACTTCCTGACACGAGGAGTGAG - UNI7518 - GCTTACCTACAACAAGTTCAAGATCTGGTGATTTTAGAGAGTATAATTTTGCAGACCTTAG 

GGTTTGAACTAACAATTGATCACCCACATACACATGTGGTAAAGTGCACCCAGCTTGTTCGAG CAAGCAAGGACTTAGCACAGACATCTTACTTCATGG

CAACCAACAG CCTGCATTTGACCACATTTAGCCTGCAGTACACACCTCCTGTGGTGGCCTGTGTCTGCATCCATCTGGCTTGCAAGTGGTCCAACTGGG

AGATCCCAGTCTCAACTGACGGGAAGCACTGGTGGGAGTATGTTGACGCCACTGTGACCTTGGAACTGTTAGATG - UNI21909 - AATTGACACAT

GAATTTCTACAGATTCTAGAGAAAACTCCAAGCAGGCTGAAACGTATTCGGAATTGGAGG - UNI25514 - GCGTACCAGGCTGCCATGAAAACCAA

GCCAGATGACCGAGGAGCAGATGAAAACACGTCGGAGCAGACAATCCTCAATATGATTTCTCAGACCTCTTCAGACACAACTATCGCAGGATTAATGAGC

ATGTCAACTGCGTCTACAAGTGCAGTGCCTTCCCTGCCTTCCTCTGAGGAGTCATCGAGCAGTCTAACTAGTGTGGATATGTTGCAGGGCGAGCGGTGGC

TGTCTTCCCAACCTCCGTTTAAACTCGAAGCTGCCCAGGGTCATCGGACTAGTGAGAGTTTAGCACTTATTGGCGTTGATCATTCCTTGCAACAGGATGG

TTCCAGTGCGTTTGGTTCCCAGAAGCAGGCGAGCAAGAGTGTGCCATCTGCTAAGGTTTCACTTAAGGAGTACCGTGCAAAGCACGCGGAAGAGTTGGCT

GCTCAGAAGAGGCAGCTGGAGAACATGGAGGCCAATGTGAAGTCACAGTATGCGTATGCTGCCCAGAATCTCCTGTCTCACGACAGCCATTCTTCAGTTA

TTCTCAAAATGCCCATTGAGAGCTCAGAAAACCCTGAACGTCCTTTTCTGGATAAGGCTGACAAATCAGCTCTGAAAATGAGACTCCCTGTGGCCAGTGG

GGATAAAGCAGTTTCTTCCAAGCCAGAGGAGATAAAGATGCGCATTAAAGTTCACTCTGCAGGGGATAAGCACAATTCCATAGAAGACAGTGTCACCAAG

AGCCGCGAGCACAAGGAGAAGCAGAGGACTCACCCGTCTAACCACCACCACCATCACAACCACCACTCACACAGGCACTCTCACTTACAGCTGCCAGCCG

GCCCCGTGAGCAAACGCCCAAGTGATCCAAAACACAGCAGCCAGACAAGCACCTTAGCACACAAAACCTACAGCTTGTCCAGTACTTTGTCTTCTTCCAG

CTCTACTCGTAAAAGGGGTCCCCCGGAAGAGACTGGGGCAGCAGTATTTGATCATCCAGCCAAGATTGCCAAGAGTACTAAATCTTCCTTGAATTTCCCC

TTCCCCCCCCTTCCTACAATGACCCAGTTGCCTGGGCATAGCTCAGACACAAGTGGCCTGCCCTTTTCACAGCCTAGCTGTAAAACTCGAGTTCCTCATA

TGAAACTGGATAAAGGCCCTCCTGGGGCTAATGGTCACAACGCAACTCAGTCAATAGATTATCAAGACACTGTGAATATGCTCCACTCCCTGCTTAGTGC

CCAGGGGGTTCAGCCCACACAGGCCCCTGCATTTGAATTTGTCCACTCTTATGGTGAATATATGAATCCCAGAGCTGGTGCCATCTCCTCCAGATCTGGC

ACTACAGACAAACCTCGGCCACCACCCCTCCCATCAGAACCCCCTCCACCACTTCCACCTCTTCCTAAGTGA
Translation
 - UNI32088 - MEGERKNNNKRWYFTREQLENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNV - UNI5573 - - UNI32088 - VSQLTI

NTAIVYMHRFYMIQSFTQFHRY - UNI4440 - SMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSE - UNI7518 - AYLQQVQDL

VILESIILQTLG GFELTIDHPHTHVVKCTQLVRA ASKDLAQTSYFMATNS SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDA

TVTLELLDE - UNI21909 - ELTHEFLQILEKTPSRLKRIRNWR - UNI25514 - AYQAAMKTKPDDRGADENTSEQTILNMISQTSSDTTIAG

LMSMSTASTSAVPSLPSSEESSSSLTSVDMLQGERWLSSQPPFKLEAAQGHRTSESLALIGVDHSLQQDGSSAFGSQKQASKSVPSAKVSLKEYRAKHAE

ELAAQKRQLENMEANVKSQYAYAAQNLLSHDSHSSVILKMPIESSENPERPFLDKADKSALKMRLPVASGDKAVSSKPEEIKMRIKVHSAGDKHNSIEDS

VTKSREHKEKQRTHPSNHHHHHNHHSHRHSHLQLPAGPVSKRPSDPKHSSQTSTLAHKTYSLSSTLSSSSSTRKRGPPEETGAAVFDHPAKIAKSTKSSL

NFPFPPLPTMTQLPGHSSDTSGLPFSQPSCKTRVPHMKLDKGPPGANGHNATQSIDYQDTVNMLHSLLSAQGVQPTQAPAFEFVHSYGEYMNPRAGAISS

RSGTTDKPRPPPLPSEPPPPLPPLPK

For any suggestions or comments, please send an email to unitrap@crg.es