Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000012429 (2810021B07Rik)
Chromosomal location
Chr 13: 17787247 - 17790939 (+)
Description
RIKEN cDNA 2810021B07 gene Gene [Source:MGI Symbol;Acc:MGI:1913558]
RefSeq_dna
NM_025479 
RefSeq_peptide
NP_079755.1 
UniGene
Mm.400217 
MGI
MGI:1913558 
Uniprot/SWISSPROT
Q9D011 
Uniprot/SPTREMBL
Q9CZC6 B2RTG9 
Human Ortholog
ENSG00000168303 (C7orf11)
Omim 234050 - TRICHOTHIODYSTROPHY, NONPHOTOSENSITIVE 1  
UniTrap UNI15966
Vector Insertion
Chr 13: 17787655 - 17788675
Public Clones (sanger) D106E11 (ggtc) IST14427E5 (tigm)
Private Clones OST469199 (lexicon) OST396479 (lexicon) OST314677 (lexicon) OST306708 (lexicon)
OST265128 (lexicon) OST253082 (lexicon) OST140370 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29963
Vector Insertion
Chr 13: 17788675 - 17788794
Public Clones (sanger) D175H08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000012573
Sequence
ATGCACCGACCGAATTTTCGACCCCCAACTCCTCCGTACCCCAGCCCGGGGATAGGAGGTTGGGGTGGCGGAAATAACTTCCGGGGTGCCCTGGGCGGGG

GGCCGCGGCCGCCCTCCCCGCGGGACGGGTACGGGAGTCCGCACCACACTCCGCCCTGC GGCCCCGGGCTAGGCCGTACGGGAGCAGCCAGTCTCCGCG

GCACGGCGGCAACTTCTCGGGGGCCCGCTTCGGGTCTCCGTCCCCGGGCGGCTACCCAGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCATCAGTTC

GGCTACTCCCCAGGGCAGCAGCAGACCTACCCCCAG - UNI15966 - - UNI29963 - GGTTCTCCAAGGACATCTACACCATTTGGATCAGGGC

GTGGTAGAGAAAAAAGAATGTCTAATGAGTTGGAAAGTTATTTTAAGCCTTCAATGCTTGAAGACCCTTGGGCTGGCCTAG
Translation
MHRPNFRPPTPPYPSPGIGGWGGGNNFRGALGGGPRPPSPRDGYGSPHHTPPC GPGLGRTGAASLRGTAATSRGPASGLRPRAATQAPTPGPPRGPSIS

SATPQGSSRPTPR - UNI15966 - - UNI29963 - RVLQGHLHHLDQGVVEKKECLMSWKVILSLQCLKTLGLA
Transcript ENSMUST00000049744
Sequence
CCTTCTGGCGGTTGATCGCAGAGGTTCCGGTGAGGCGTTCGGCGTGTGAGCTCTGCGGCTTCGTTTCCTGATATGCACCGACCGAATTTTCGACCCCCAA

CTCCTCCGTACCCCAGCCCGGGGATAGGAGGTTGGGGTGGCGGAAATAACTTCCGGGGTGCCCTGGGCGGGGGGCCGCGGCCGCCCTCCCCGCGGGACGG

GTACGGGAGTCCGCACCACACTCCGCCCTGCGGGCCCCGGGCTAGGCCGTACGGGAGCAGCCAGTCTCCGCGGCACGGCGGCAACTTCTCGGGGGCCCGC

TTCGGGTCTCCGTCCCCGGGCGGCTACCCAGGCTCCTACTCCAGGTCCCCCGCGGGGTCCCAGCATCAGTTCGGCTACTCCCCAGGGCAGCAGCAGACCT

ACCCCCAG - UNI15966 - - UNI29963 - GGTTCTCCAAGGACATCTACACCATTTGGATCAGGGCGTGGTAGAGAAAAAAGAATGTCTAATGA

GTTGGAAAGTTATTTTAAGCCTTCAATGCTTGAAGACCCTTGGGCTGGCCTAGAACCAGTGTCTGTAGTGGATATAAGCCAACAGTACAGCAATACGCAA

ACATTCACAGGCAAAAAAGGAAGATACTTTTCTTAATATTTCTGAAATTCACCTGGAAGCTTCATGTGTCAGGAACATCCTGGACAGAACTTTTACTTGT

GTAAAAGAGTTGAACCCAAGGATGATGACTTTGAATAATGATTAGCAGACCTTTGGTATATCTCCAACTTTATCAAGTGTTGATAACAGCGGAAATGATA

GGACAATTTACAGTATTTAGCTATCTGGGAGTGTGTATCATAGAACACAGTTTTCATATTTGACATTTCCAATATAACAGACATTTGTTTTTTTCAATGT

TTTAAAATAAAACGTTTTTTGTCTTCCTAATTGTGATTTTTGTGAATATGTAGAATTGCTAAAACAATGCTTCAGTAATCACTTAGACTTTGAGGGTAAA

TGTTTTGCAAACTATTTTTTAATGAAATGACAAGCTATCTTAGACAGTTTTCTATATATTTATTAATAGAAAATAGTTCTACATCCATTTTTTTGTATTT

TTGTTAAGATATTGAAACTTAAAATCACTGGAAGTCACTTAATATGATTTATACTTCTTTATTCACAAAAGGCCAGAATAAACTATATATATGCAGTTCA

GTGCTCTGCCCAAATTTCTCTATATTTGGAGCATTGTAGGCTTACTTTCTCTTGAAGCAAAAGAAGGTGGTATGTTGATTTTCATTGTGATAAAATGCCA

AAGGAAAACCAAGGAGGGACTTTGGTTCATAGTTTCTAAAGTTCCAGTGGAAGTTCAGCTGGATCTATTAGTTGGTCTTGAGGTGAATCAAAATATGTCT

GCGGATATGGCAAAAGCTGTTCACCTTTGGCAACCAAGCTGCAGAAAGACAGGAGGAGGCCAGGGATAAGAGGAGCCTTTCTAGAGCAACTTTGCCTGTC

TCTACCTCCCAGTGATAACATCATGTGACCCATTAAGGTATTAGTCCACTTAGGAAGTAAATACCCTGACAATCTCATCACTTCCCTGTGACCAGACAAG

CCTTCAACACATGACCCATTTGGGCAGACACTTCATATCCATACCACAACAAATGACTAATAGTAATCTCAAATGACTTCCATGACAACGAAATAAATAT

ATATTTGACTCCATCAAACCAAAGAAGACAAATGATAATGCAAGTTTACTGTGTCTGAGACAGTAAGGCCTAATTATCTTGACTCATAGACACATTTTTT

TAATATTTTTTATTAGATATTTTCTTTATATACATTTCAAATGCTATCCCGAAAGTTCCCTATACCCTCCCCCCAGCCCTGCTCCCCTACAAGAAGCTCA

CTCCAGCTTCTTGGCCCTGGTGTTCCCCTGTACTGAGGCATATAAAGTTTGCAAGAGCAAGGGGCCTCTCTTCCCAGTGATGGCCGACTAGGCCATCTTC

TGCTACATATGCAGCTAGAGACACGAGCTGTGGGGGTACTGGTTAGTTCATATTGTTGTATGGACACATTTCTAATCTGAGGAAGAGTTCTATGAACTTT

AGCTTACTTTGCCTGGCTGGAGTACAAGGAAAGGGATGCTATGTATATATACCTGTATTAATAGAGCTAAAACTTGGAGGAGTATTCCTGAGTTATTTAA

AGTCAAGTCTTGAACAGTACAGTATGTTTAAAAAAATTGTCGACATTCTCCAAAAGGAAAATGAAATGGCCATTCCACCTAGGTAAGCCATAACTATTTG

TTATTGGGGTGGGGACCCACTGGAAGGATTTTATGCAAATAAAACCTCCACTGGAGCCAGAGCTTTGAAACTTTTCTACTAGTTATTAGCTAGATATCCC

AGTTTTATCATGTAAAATGAGGAAATTCATAGTACTTGTCTTCATTTAACCCTATATTCTGAGTTTTTAGAATACTGCCTATAAAATAACGGGCACTAAG

TAAATGTTTAATCAATACATGAATTCTGGTTGTAACTGTTATATTGCTCTGCCTAGTCTCATGTGTAAAGGGGTTAATAGAGGGATGTTATGTGGCTATT

TGAAAGAAAACGTCCATACTCAACATCTTGGGTTTTTTTCCATATATTTTATATTTGATACTTATTGAAATTCATAAATAAAAAATAACACTTGAAAAC
Translation
MHRPNFRPPTPPYPSPGIGGWGGGNNFRGALGGGPRPPSPRDGYGSPHHTPPCGPRARPYGSSQSPRHGGNFSGARFGSPSPGGYPGSYSRSPAGSQHQF

GYSPGQQQTYPQ - UNI15966 - - UNI29963 - GSPRTSTPFGSGRGREKRMSNELESYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKK

GRYFS

For any suggestions or comments, please send an email to unitrap@crg.es