Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013033 (Lphn1)
Chromosomal location
Chr 8: 86424614 - 86463872 (+)
Description
latrophilin 1 Gene [Source:MGI Symbol;Acc:MGI:1929461]
RefSeq_peptide
NP_851382.2 
UniGene
Mm.260733 
MGI
MGI:1929461 
Uniprot/SWISSPROT
Q80TR1 
Uniprot/SPTREMBL
Q3UYB4 Q5U4D5 
Human Ortholog
ENSG00000072071 (LPHN1)
Omim not available
UniTrap UNI33695
Vector Insertion
Chr 8: 86424824 - 86439305
Public Clones IST14564E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28072
Vector Insertion
Chr 8: 86439305 - 86439468
Public Clones not available
Private Clones OST40828 (lexicon) OST39571 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26406
Vector Insertion
Chr 8: 86439468 - 86442718
Public Clones not available
Private Clones OST119500 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18854
Vector Insertion
Chr 8: 86446897 - 86447008
Public Clones not available
Private Clones OST412966 (lexicon) OST56723 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116450
Sequence
CCCCCCCCCCACCCCTTCCCTTTTAAATTTTGGTCGGTGGCGGCGGTGCTGGGCCGGAGGAAAGAAGGGACACGGAGTCCTCCCTCGCTCAGCCACCCCC

TCCCCGCTTCCCCCTGGGCCGGGCTCCGGGAGATGTGCCGGGCGGGGGGCCCGGCTTCGCGGAGCCGCCGGAGGAGCGCGCACGGCCGACCCCGAAGCGC

CGCTGGACAG - UNI28072 - - UNI33695 - GCTGGTGGGCCAGGCCGTGGTACCCTGGTGATGCGGGGCGAGGCCCCCCCCACAGTCCGCTGA

GATCCCTGTGCCCAACCCTGGCCTTCGCCATGGCCCGCTTGGCTGCAGCACTCTGGAGTCTCTGTGTGACGACTGTCCTTGTCACCTCTGCCACCCAAG 

- UNI26406 - - UNI28072 - GCCTGAGCCGGGCTGGGCTCCCATTTGGGTTGATGCGCCGGGAGCTAGCATGTGAGGGCTACCCCATCGAGCTG

CGGTGCCCGGGGAGTGATGTCATCATGGTGGAGAATGCAAACTACGGGCGCACAGATGACAAGATCTGCGATGCCGACCCTTTCCAGATGGAGAATGTGC

AGTGCTACTTGCCTGACGCCTTCAAAATCATGTCACAGAG - UNI18854 - GTGTAATAACCGAACCCAGTGTGTGGTGGTGGCCGGCTCTGACGCC

TTTCCTGACCCCTGTCCTGGAACCTACAAATACCTGGAGGTGCAGTACGACTGTGTCCCTTACA - UNI18854 - AAGTGGAGCAGAAAG TCTTCG

TGTGCCCAGGGACCCTGCAGAAGGTGCTGGAGCCCACCTCTACACATGAGTCAGAGCATCAGTCTGGTGCATGGTGCAAGGACCCGCTGCAGGCAGGTGA

CCGTATCTACGTTATGCCCTGGATCCCCTACCGCACGGACACATTGACTGAATATGCCTCATGGGAGGACTATGTAGCCGCACGCCACACCACCACGTAC

AGACTGCCCAACCGTGTAGATGGCACTGGCTTTGTGGTCTACGATGGCGCAGTCTTCTACAACAAGGAGCGCACTCGCAACATTGTCAAATATGACCTGC

GGACCCGCATCAAGAGCGGGGAAACTGTCATAAACACAGCCAACTACCACGATACCTCACCTTACCGCTGGGGAGGTAAAACCGACATTGACCTGGCAGT

AGATGAGAACGGACTGTGGGTCATCTATGCAACTGAGGGCAACAATGGGCGCTTGGTGGTAAGCCAGCTCAACCCCTACACGTTGCGTTTTGAGGGCACT

TGGGAAACAGGCTATGACAAGCGCTCGGCCTCCAATGCCTTCATGGTGTGCGGCGTCCTCTATGTGCTGCGTTCTGTCTATGTGGACGATGATAGCGAGG

CCGCAGGCAACCGCGTGGACTATGCCTTCAACACCAATGCGAACCGTGAGGAGCCCGTCAGTCTGGCCTTCCCCAACCCCTACCAGTTCGTATCTTCTGT

TGACTACAACCCCCGGGACAACCAGCTCTATGTATGGAACAACTACTTTGTTGTGCGCTATAGCCTGGAGTTTGGACCCCCAGATCCCAGTGCTG GCCC

AGCCACTTCCCCGCCTCTCAGTACCACCACCACAGCCCGGCCCACACCCCTCACCAGCACAGCCTCGCCTGCAGCCACCACTCCACTCCGCCGGGCACCC

CTCACCACACACCCAGTGGGTGCCATCAACCAGCTGGGACCTGACCTGCCTCCAGCCACAGCTCCAGCACCCAGTACCCGAAGGCCTCCAGCCCCCAATC

TGCATGTGTCCCCTGAGCTCTTCTGTGAACCCAGAGAGGTCCGGCGGGTCCAGTGGCCAGCTACCCAACAGGGTATGCTGGTGGAGAGACCTTGCCCCAA

GGGAACTCGAG GAATTGCCTCATTCCAGTGCCTCCCAGCTCTGGGGCTCTGGAATCCTCGGGGCCCTGACCTCAGCAACTGCACTTCTCCCTGGGTCAA

CCAAGTAGCCCAGAAG ATCAAGAGTGGAGAGAATGCGGCCAACATTGCCAGTGAGCTGGCCCGCCACACACGGGGCTCTATCTATGCTGGGGACGTGTC

CTCCTCAGTGAAGCTGATGGAACAACTGCTAGATATCCTGGATGCCCAGCTCCAGGCCCTACGGCCCATTGAACGAGAGTCAGCCGGCAAGAACTACAAT

AAG ATGCACAAGCGAGAGAGAACCTGCAAGGACTACATCAAG GCTGTGGTGGAGACAGTGGATAACCTGCTTCGGCCGGAGGCGCTTGAGTCATGGAA

AGACATGAATGCCACCGAACAGGTTCATACAGCCACCATGCTTCTAGATGTCCTGGAGGAGGGTGCCTTCCTGCTGGCTGACAATGTCAGAGAACCTGCT

CGCTTCTTGGCTGCCAAGCAGAACGTGG TCCTGGAGGTAACTGTGCTGAACACGGAGGGCCAAGTGCAGGAGTTGGTGTTCCCCCAAGAGTATCCCAGT

GAGAACTCCATTCAGCTCTCCGCCAACACCATCAAGCAGAACAGCCGCAACG GTGTGGTGAAAGTTGTCTTCATTCTCTACAACAACCTGGGCCTCTTC

TTGTCCACGGAGAATGCCACAGTGAAGCTGGCAGGTGAGGCAGGGACAGGTGGCCCTGGAGGTGCCTCCCTGGTGGTCAACTCACAGGTCATCGCAGCAT

CTATCAATAAGGAGTCTAGCCGCGTCTTCCTCATGGACCCTGTCATCTTTACTGTAGCCCACTTGGAG GCCAAGAACCACTTCAATGCAAACTGCTCCT

TCTGGAACTACTCAGAGCGCTCCATGCTGGGCTACTGGTCAACCCAGGGCTGCCGATTGGTGGAGTCCAATAAGACCCATACCACATGTGCCTGCAGCCA

CCTCACCAACTTCGCAGTGCTCATGGCTCACCGAGAGATC TACCAAGGCCGTATTAATGAGCTGCTGCTGTCAGTCATCACCTGGGTTGGTATTGTCAT

CTCCCTGGTCTGTCTGGCTATCTGCATCTCCACCTTCTGCTTCCTGCGGGGCTTGCAGACTGACCGCAACACCATCCACAAGAATCTGTGCATCAACCTC

TTCCTTGCGGAGCTGCTCTTCCTGGTTGGAATAGATAAAACTCAGTATGAG GTCGCCTGCCCTATCTTTGCGGGACTGCTGCACTACTTCTTCCTGGCC

GCCTTCTCCTGGCTGTGCCTGGAGGGCGTGCACCTCTACCTGTTGCTGGTGGAGGTGTTCGAGAGCGAGTATTCACGCACCAAGTACTATTACCTAGGTG

GCTACTGCTTCCCAGCCCTGGTGGTCGGCATCGCAGCAGCCATTGACTACCGAAGCTACGGCACTGAAAAGGC CTGCTGGCTGAGGGTGGATAACTACT

TCATCTGGAGCTTCATTGGGCCCGTCTCGTTTGTCATTGTG GTGAACCTGGTGTTCCTCATGGTGACCCTGCACAAGATGATCCGAAGCTCATCAGTGC

TCAAGCCTGACTCTAGTCGCCTTGACAACATCAA GTCCTGGGCGCTGGGTGCCATTGCACTGCTCTTCCTGCTGGGCCTCACCTGGGCTTTCGGCCTCC

TCTTCATCAACAAAGAGTCAGTAGTCATGGCCTATCTCTTCACTACCTTCAACGCCTTCCAGGGGGTCTTCATCTTTGTCTTTCACTGCGCCTTACAGAA

AAAG GTGCACAAGGAGTACAGCAAGTGCCTGCGTCACTCCTACTGCTGCATCCGCTCCCCACCTGGGGGCACTCACGGCTCCCTTAAGACCTCAGCCAT

GCGAAGTAACACCCGATACTACACAGGGACCCAG AGCCGAATCCGGAGGATGTGGAATGACACCGTGAGGAAGCAGACAGAGTCCTCCTTTATGGCAGG

TGACATCAACAGCACCCCCACCCTGAACCGAG GTACCATGGGGAACCACCTACTGACCAACCCCGTGCTACAGCCTCGTGGGGGCACTAGCCCATACAA

TACACTCATTGCAGAGTCCGTGGGCTTCAATCCCTCCTCGCCCCCAGTCTTCAACTCCCCAG GAAGCTACAGGGAACCCA AGCACCCCTTGGGAGGCC

GGGAAGCCTGTGGCATGGACACCCTGCCACTTAACGGCAACTTCAACAACAGCTACTCCTTGCGAAGCGGTGATTTCCCTCCAGGGGATGGGGGTCCCGA

GCCACCCCGAGGCCGGAACCTGGCAGATGCTGCCGCCTTTGAGAAGATGATCATCTCAGAGCTGGTGCACAACAACCTGCGAGGGGCCAGTGGGGGTGCC

AAAGGGCCTCCACCAGAGCCACCTGTGCCACCTGTGCCAGGGGTCAGTGAGGACGAGGCCGGTGGACCAGGGAGTGCTGACCGGGCAGAGATTGAACTTC

TCTACAAGGCCCTGGAGGAGCCGCTGCTGCTGCCCCGGGCCCAGTCGGTGCTGTACCAGAGTGATCTGGATGAGTCGGAGAGCTGTACGGCAGAGGATGG

GGCCACCAGCCGGCCCCTCTCCTCCCCTCCCGGCCGGGACTCCCTCTATGCCAGCGGGGCCAACCTGCGGGACTCGCCCTCCTACCCGGACAGCAGCCCG

GAAGGGCCTAATGAGGCCCTGCCCCCGCCCCCACCTGCTCCCCCTGGGCCCCCAGAAATCTACTACACCTCTCGCCCGCCGGCCCTGGTGGCTCGGAATC

CCCTACAGGGCTACTACCAGGTGCGGCGGCCCAGCCATGAAGGCTACCTGGCAGCCCCCAGCCTCGAGGGGCCAGGGCCCGATGGGGACGGGCAAATGCA

GTTGGTCACTAGTCTCTGA
Translation
 - UNI28072 - - UNI33695 -  - UNI26406 - - UNI28072 -  - UNI18854 -  - UNI18854 -  MPWIPYRTDTLTEYASW

EDYVAARHTTTYRLPNRVDGTGFVVYDGAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVS

QLNPYTLRFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSLAFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYS

LEFGPPDPSAG GPATSPPLSTTTTARPTPLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPAPSTRRPPAPNLHVSPELFCEPREVRRVQWP

ATQQGMLVERPCPKGTRG GIASFQCLPALGLWNPRGPDLSNCTSPWVNQVAQK IKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQL

QALRPIERESAGKNYNK MHKRERTCKDYIK AVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKQNVV VLEVT

VLNTEGQVQELVFPQEYPSENSIQLSANTIKQNSRNG GVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGASLVVNSQVIAASINKESSRVFLMD

PVIFTVAHLE AKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTNFAVLMAHREI YQGRINELLLSVITWVGIVISLVCLAICIST

FCFLRGLQTDRNTIHKNLCINLFLAELLFLVGIDKTQYE VACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGI

AAAIDYRSYGTEKA ACWLRVDNYFIWSFIGPVSFVIV VNLVFLMVTLHKMIRSSSVLKPDSSRLDNIK KSWALGAIALLFLLGLTWAFGLLFINKES

VVMAYLFTTFNAFQGVFIFVFHCALQKK VHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNTRYYTGTQ SRIRRMWNDTVRKQTESSFMAGDINST

PTLNRG GTMGNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPG GSYREPK KHPLGGREACGMDTLPLNGNFNNSYSLRSGDFPPGDGGPE

PPRGRNLADAAAFEKMIISELVHNNLRGASGGAKGPPPEPPVPPVPGVSEDEAGGPGSADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDG

ATSRPLSSPPGRDSLYASGANLRDSPSYPDSSPEGPNEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQVRRPSHEGYLAAPSLEGPGPDGDGQMQ

LVTSL
Transcript ENSMUST00000045393
Sequence
CCCCCCCCCCACCCCTTCCCTTTTAAATTTTGGTCGGTGGCGGCGGTGCTGGGCCGGAGGAAAGAAGGGACACGGAGTCCTCCCTCGCTCAGCCACCCCC

TCCCCGCTTCCCCCTGGGCCGGGCTCCGGGAGATGTGCCGGGCGGGGGGCCCGGCTTCGCGGAGCCGCCGGAGGAGCGCGCACGGCCGACCCCGAAGCGC

CGCTGGACAG - UNI28072 - - UNI33695 - GCTGGTGGGCCAGGCCGTGGTACCCTGGTGATGCGGGGCGAGGCCCCCCCCACAGTCCGCTGA

GATCCCTGTGCCCAACCCTGGCCTTCGCCATGGCCCGCTTGGCTGCAGCACTCTGGAGTCTCTGTGTGACGACTGTCCTTGTCACCTCTGCCACCCAAG 

- UNI26406 - - UNI28072 - GCCTGAGCCGGGCTGGGCTCCCATTTGGGTTGATGCGCCGGGAGCTAGCATGTGAGGGCTACCCCATCGAGCTG

CGGTGCCCGGGGAGTGATGTCATCATGGTGGAGAATGCAAACTACGGGCGCACAGATGACAAGATCTGCGATGCCGACCCTTTCCAGATGGAGAATGTGC

AGTGCTACTTGCCTGACGCCTTCAAAATCATGTCACAGAG - UNI18854 - GTGTAATAACCGAACCCAGTGTGTGGTGGTGGCCGGCTCTGACGCC

TTTCCTGACCCCTGTCCTGGAACCTACAAATACCTGGAGGTGCAGTACGACTGTGTCCCTTACA - UNI18854 - TCTTCGTGTGCCCAGGGACCCT

GCAGAAGGTGCTGGAGCCCACCTCTACACATGAGTCAGAGCATCAGTCTGGTGCATGGTGCAAGGACCCGCTGCAGGCAGGTGACCGTATCTACGTTATG

CCCTGGATCCCCTACCGCACGGACACATTGACTGAATATGCCTCATGGGAGGACTATGTAGCCGCACGCCACACCACCACGTACAGACTGCCCAACCGTG

TAGATGGCACTGGCTTTGTGGTCTACGATGGCGCAGTCTTCTACAACAAGGAGCGCACTCGCAACATTGTCAAATATGACCTGCGGACCCGCATCAAGAG

CGGGGAAACTGTCATAAACACAGCCAACTACCACGATACCTCACCTTACCGCTGGGGAGGTAAAACCGACATTGACCTGGCAGTAGATGAGAACGGACTG

TGGGTCATCTATGCAACTGAGGGCAACAATGGGCGCTTGGTGGTAAGCCAGCTCAACCCCTACACGTTGCGTTTTGAGGGCACTTGGGAAACAGGCTATG

ACAAGCGCTCGGCCTCCAATGCCTTCATGGTGTGCGGCGTCCTCTATGTGCTGCGTTCTGTCTATGTGGACGATGATAGCGAGGCCGCAGGCAACCGCGT

GGACTATGCCTTCAACACCAATGCGAACCGTGAGGAGCCCGTCAGTCTGGCCTTCCCCAACCCCTACCAGTTCGTATCTTCTGTTGACTACAACCCCCGG

GACAACCAGCTCTATGTATGGAACAACTACTTTGTTGTGCGCTATAGCCTGGAGTTTGGACCCCCAGATCCCAGTGCTG GCCCAGCCACTTCCCCGCCT

CTCAGTACCACCACCACAGCCCGGCCCACACCCCTCACCAGCACAGCCTCGCCTGCAGCCACCACTCCACTCCGCCGGGCACCCCTCACCACACACCCAG

TGGGTGCCATCAACCAGCTGGGACCTGACCTGCCTCCAGCCACAGCTCCAGCACCCAGTACCCGAAGGCCTCCAGCCCCCAATCTGCATGTGTCCCCTGA

GCTCTTCTGTGAACCCAGAGAGGTCCGGCGGGTCCAGTGGCCAGCTACCCAACAGGGTATGCTGGTGGAGAGACCTTGCCCCAAGGGAACTCGAG GAAT

TGCCTCATTCCAGTGCCTCCCAGCTCTGGGGCTCTGGAATCCTCGGGGCCCTGACCTCAGCAACTGCACTTCTCCCTGGGTCAACCAAGTAGCCCAGAAG

 ATCAAGAGTGGAGAGAATGCGGCCAACATTGCCAGTGAGCTGGCCCGCCACACACGGGGCTCTATCTATGCTGGGGACGTGTCCTCCTCAGTGAAGCTG

ATGGAACAACTGCTAGATATCCTGGATGCCCAGCTCCAGGCCCTACGGCCCATTGAACGAGAGTCAGCCGGCAAGAACTACAATAAG ATGCACAAGCGA

GAGAGAACCTGCAAGGACTACATCAAG GCTGTGGTGGAGACAGTGGATAACCTGCTTCGGCCGGAGGCGCTTGAGTCATGGAAAGACATGAATGCCACC

GAACAGGTTCATACAGCCACCATGCTTCTAGATGTCCTGGAGGAGGGTGCCTTCCTGCTGGCTGACAATGTCAGAGAACCTGCTCGCTTCTTGGCTGCCA

AGCAGAACGTGG TCCTGGAGGTAACTGTGCTGAACACGGAGGGCCAAGTGCAGGAGTTGGTGTTCCCCCAAGAGTATCCCAGTGAGAACTCCATTCAGC

TCTCCGCCAACACCATCAAGCAGAACAGCCGCAACG GTGTGGTGAAAGTTGTCTTCATTCTCTACAACAACCTGGGCCTCTTCTTGTCCACGGAGAATG

CCACAGTGAAGCTGGCAGGTGAGGCAGGGACAGGTGGCCCTGGAGGTGCCTCCCTGGTGGTCAACTCACAGGTCATCGCAGCATCTATCAATAAGGAGTC

TAGCCGCGTCTTCCTCATGGACCCTGTCATCTTTACTGTAGCCCACTTGGAG GCCAAGAACCACTTCAATGCAAACTGCTCCTTCTGGAACTACTCAGA

GCGCTCCATGCTGGGCTACTGGTCAACCCAGGGCTGCCGATTGGTGGAGTCCAATAAGACCCATACCACATGTGCCTGCAGCCACCTCACCAACTTCGCA

GTGCTCATGGCTCACCGAGAGATC TACCAAGGCCGTATTAATGAGCTGCTGCTGTCAGTCATCACCTGGGTTGGTATTGTCATCTCCCTGGTCTGTCTG

GCTATCTGCATCTCCACCTTCTGCTTCCTGCGGGGCTTGCAGACTGACCGCAACACCATCCACAAGAATCTGTGCATCAACCTCTTCCTTGCGGAGCTGC

TCTTCCTGGTTGGAATAGATAAAACTCAGTATGAG GTCGCCTGCCCTATCTTTGCGGGACTGCTGCACTACTTCTTCCTGGCCGCCTTCTCCTGGCTGT

GCCTGGAGGGCGTGCACCTCTACCTGTTGCTGGTGGAGGTGTTCGAGAGCGAGTATTCACGCACCAAGTACTATTACCTAGGTGGCTACTGCTTCCCAGC

CCTGGTGGTCGGCATCGCAGCAGCCATTGACTACCGAAGCTACGGCACTGAAAAGGC CTGCTGGCTGAGGGTGGATAACTACTTCATCTGGAGCTTCAT

TGGGCCCGTCTCGTTTGTCATTGTG GTGAACCTGGTGTTCCTCATGGTGACCCTGCACAAGATGATCCGAAGCTCATCAGTGCTCAAGCCTGACTCTAG

TCGCCTTGACAACATCAA GTCCTGGGCGCTGGGTGCCATTGCACTGCTCTTCCTGCTGGGCCTCACCTGGGCTTTCGGCCTCCTCTTCATCAACAAAGA

GTCAGTAGTCATGGCCTATCTCTTCACTACCTTCAACGCCTTCCAGGGGGTCTTCATCTTTGTCTTTCACTGCGCCTTACAGAAAAAG GTGCACAAGGA

GTACAGCAAGTGCCTGCGTCACTCCTACTGCTGCATCCGCTCCCCACCTGGGGGCACTCACGGCTCCCTTAAGACCTCAGCCATGCGAAGTAACACCCGA

TACTACACAGGGACCCAG AGCCGAATCCGGAGGATGTGGAATGACACCGTGAGGAAGCAGACAGAGTCCTCCTTTATGGCAGGTGACATCAACAGCACC

CCCACCCTGAACCGAG GTACCATGGGGAACCACCTACTGACCAACCCCGTGCTACAGCCTCGTGGGGGCACTAGCCCATACAATACACTCATTGCAGAG

TCCGTGGGCTTCAATCCCTCCTCGCCCCCAGTCTTCAACTCCCCAG GAAGCTACAGGGAACCCA AGCACCCCTTGGGAGGCCGGGAAGCCTGTGGCAT

GGACACCCTGCCACTTAACGGCAACTTCAACAACAGCTACTCCTTGCGAAGCGGTGATTTCCCTCCAGGGGATGGGGGTCCCGAGCCACCCCGAGGCCGG

AACCTGGCAGATGCTGCCGCCTTTGAGAAGATGATCATCTCAGAGCTGGTGCACAACAACCTGCGAGGGGCCAGTGGGGGTGCCAAAGGGCCTCCACCAG

AGCCACCTGTGCCACCTGTGCCAGGGGTCAGTGAGGACGAGGCCGGTGGACCAGGGAGTGCTGACCGGGCAGAGATTGAACTTCTCTACAAGGCCCTGGA

GGAGCCGCTGCTGCTGCCCCGGGCCCAGTCGGTGCTGTACCAGAGTGATCTGGATGAGTCGGAGAGCTGTACGGCAGAGGATGGGGCCACCAGCCGGCCC

CTCTCCTCCCCTCCCGGCCGGGACTCCCTCTATGCCAGCGGGGCCAACCTGCGGGACTCGCCCTCCTACCCGGACAGCAGCCCGGAAGGGCCTAATGAGG

CCCTGCCCCCGCCCCCACCTGCTCCCCCTGGGCCCCCAGAAATCTACTACACCTCTCGCCCGCCGGCCCTGGTGGCTCGGAATCCCCTACAGGGCTACTA

CCAGGTGCGGCGGCCCAGCCATGAAGGCTACCTGGCAGCCCCCAGCCTCGAGGGGCCAGGGCCCGATGGGGACGGGCAAATGCAGTTGGTCACTAGTCTC

TGA
Translation
 - UNI28072 - - UNI33695 - MARLAAALWSLCVTTVLVTSATQG - UNI26406 - - UNI28072 - GLSRAGLPFGLMRRELACEGYP

IELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQR - UNI18854 - RCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVP

YI - UNI18854 - IFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYD

GAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTLRFEGTWETGYDKRSASNAFM

VCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSLAFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAG GPATSPPLSTTTTAR

PTPLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPAPSTRRPPAPNLHVSPELFCEPREVRRVQWPATQQGMLVERPCPKGTRG GIASFQCL

PALGLWNPRGPDLSNCTSPWVNQVAQK IKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAGKNYNK MHKRERTCK

DYIK AVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKQNVV VLEVTVLNTEGQVQELVFPQEYPSENSIQLSA

NTIKQNSRNG GVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGASLVVNSQVIAASINKESSRVFLMDPVIFTVAHLE AKNHFNANCSFWNYSE

RSMLGYWSTQGCRLVESNKTHTTCACSHLTNFAVLMAHREI YQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCINLFLAEL

LFLVGIDKTQYE VACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKA ACWLRVDNYFIW

SFIGPVSFVIV VNLVFLMVTLHKMIRSSSVLKPDSSRLDNIK KSWALGAIALLFLLGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQK

K VHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNTRYYTGTQ SRIRRMWNDTVRKQTESSFMAGDINSTPTLNRG GTMGNHLLTNPVLQPRGGTS

PYNTLIAESVGFNPSSPPVFNSPG GSYREPK KHPLGGREACGMDTLPLNGNFNNSYSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLR

GASGGAKGPPPEPPVPPVPGVSEDEAGGPGSADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPGRDSLYASGANLRDSPS

YPDSSPEGPNEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQVRRPSHEGYLAAPSLEGPGPDGDGQMQLVTSL
Transcript ENSMUST00000093386
Sequence
CCCCCCCCCCACCCCTTCCCTTTTAAATTTTGGTCGGTGGCGGCGGTGCTGGGCCGGAGGAAAGAAGGGACACGGAGTCCTCCCTCGCTCAGCCACCCCC

TCCCCGCTTCCCCCTGGGCCGGGCTCCGGGAGATGTGCCGGGCGGGGGGCCCGGCTTCGCGGAGCCGCCGGAGGAGCGCGCACGGCCGACCCCGAAGCGC

CGCTGGACAG - UNI28072 - - UNI33695 - GCTGGTGGGCCAGGCCGTGGTACCCTGGTGATGCGGGGCGAGGCCCCCCCCACAGTCCGCTGA

GATCCCTGTGCCCAACCCTGGCCTTCGCCATGGCCCGCTTGGCTGCAGCACTCTGGAGTCTCTGTGTGACGACTGTCCTTGTCACCTCTGCCACCCAAG 

- UNI26406 - - UNI28072 - GCCTGAGCCGGGCTGGGCTCCCATTTGGGTTGATGCGCCGGGAGCTAGCATGTGAGGGCTACCCCATCGAGCTG

CGGTGCCCGGGGAGTGATGTCATCATGGTGGAGAATGCAAACTACGGGCGCACAGATGACAAGATCTGCGATGCCGACCCTTTCCAGATGGAGAATGTGC

AGTGCTACTTGCCTGACGCCTTCAAAATCATGTCACAGAG - UNI18854 - GTGTAATAACCGAACCCAGTGTGTGGTGGTGGCCGGCTCTGACGCC

TTTCCTGACCCCTGTCCTGGAACCTACAAATACCTGGAGGTGCAGTACGACTGTGTCCCTTACA - UNI18854 - AAGTGGAGCAGAAAG TCTTCG

TGTGCCCAGGGACCCTGCAGAAGGTGCTGGAGCCCACCTCTACACATGAGTCAGAGCATCAGTCTGGTGCATGGTGCAAGGACCCGCTGCAGGCAGGTGA

CCGTATCTACGTTATGCCCTGGATCCCCTACCGCACGGACACATTGACTGAATATGCCTCATGGGAGGACTATGTAGCCGCACGCCACACCACCACGTAC

AGACTGCCCAACCGTGTAGATGGCACTGGCTTTGTGGTCTACGATGGCGCAGTCTTCTACAACAAGGAGCGCACTCGCAACATTGTCAAATATGACCTGC

GGACCCGCATCAAGAGCGGGGAAACTGTCATAAACACAGCCAACTACCACGATACCTCACCTTACCGCTGGGGAGGTAAAACCGACATTGACCTGGCAGT

AGATGAGAACGGACTGTGGGTCATCTATGCAACTGAGGGCAACAATGGGCGCTTGGTGGTAAGCCAGCTCAACCCCTACACGTTGCGTTTTGAGGGCACT

TGGGAAACAGGCTATGACAAGCGCTCGGCCTCCAATGCCTTCATGGTGTGCGGCGTCCTCTATGTGCTGCGTTCTGTCTATGTGGACGATGATAGCGAGG

CCGCAGGCAACCGCGTGGACTATGCCTTCAACACCAATGCGAACCGTGAGGAGCCCGTCAGTCTGGCCTTCCCCAACCCCTACCAGTTCGTATCTTCTGT

TGACTACAACCCCCGGGACAACCAGCTCTATGTATGGAACAACTACTTTGTTGTGCGCTATAGCCTGGAGTTTGGACCCCCAGATCCCAGTGCTG GCCC

AGCCACTTCCCCGCCTCTCAGTACCACCACCACAGCCCGGCCCACACCCCTCACCAGCACAGCCTCGCCTGCAGCCACCACTCCACTCCGCCGGGCACCC

CTCACCACACACCCAGTGGGTGCCATCAACCAGCTGGGACCTGACCTGCCTCCAGCCACAGCTCCAGCACCCAGTACCCGAAGGCCTCCAGCCCCCAATC

TGCATGTGTCCCCTGAGCTCTTCTGTGAACCCAGAGAGGTCCGGCGGGTCCAGTGGCCAGCTACCCAACAGGGTATGCTGGTGGAGAGACCTTGCCCCAA

GGGAACTCGAG GAATTGCCTCATTCCAGTGCCTCCCAGCTCTGGGGCTCTGGAATCCTCGGGGCCCTGACCTCAGCAACTGCACTTCTCCCTGGGTCAA

CCAAGTAGCCCAGAAG ATCAAGAGTGGAGAGAATGCGGCCAACATTGCCAGTGAGCTGGCCCGCCACACACGGGGCTCTATCTATGCTGGGGACGTGTC

CTCCTCAGTGAAGCTGATGGAACAACTGCTAGATATCCTGGATGCCCAGCTCCAGGCCCTACGGCCCATTGAACGAGAGTCAGCCGGCAAGAACTACAAT

AAG ATGCACAAGCGAGAGAGAACCTGCAAGGACTACATCAAG GCTGTGGTGGAGACAGTGGATAACCTGCTTCGGCCGGAGGCGCTTGAGTCATGGAA

AGACATGAATGCCACCGAACAGGTTCATACAGCCACCATGCTTCTAGATGTCCTGGAGGAGGGTGCCTTCCTGCTGGCTGACAATGTCAGAGAACCTGCT

CGCTTCTTGGCTGCCAAGCAGAACGTGG TCCTGGAGGTAACTGTGCTGAACACGGAGGGCCAAGTGCAGGAGTTGGTGTTCCCCCAAGAGTATCCCAGT

GAGAACTCCATTCAGCTCTCCGCCAACACCATCAAGCAGAACAGCCGCAACG GTGTGGTGAAAGTTGTCTTCATTCTCTACAACAACCTGGGCCTCTTC

TTGTCCACGGAGAATGCCACAGTGAAGCTGGCAGGTGAGGCAGGGACAGGTGGCCCTGGAGGTGCCTCCCTGGTGGTCAACTCACAGGTCATCGCAGCAT

CTATCAATAAGGAGTCTAGCCGCGTCTTCCTCATGGACCCTGTCATCTTTACTGTAGCCCACTTGGAG GCCAAGAACCACTTCAATGCAAACTGCTCCT

TCTGGAACTACTCAGAGCGCTCCATGCTGGGCTACTGGTCAACCCAGGGCTGCCGATTGGTGGAGTCCAATAAGACCCATACCACATGTGCCTGCAGCCA

CCTCACCAACTTCGCAGTGCTCATGGCTCACCGAGAGATC TACCAAGGCCGTATTAATGAGCTGCTGCTGTCAGTCATCACCTGGGTTGGTATTGTCAT

CTCCCTGGTCTGTCTGGCTATCTGCATCTCCACCTTCTGCTTCCTGCGGGGCTTGCAGACTGACCGCAACACCATCCACAAGAATCTGTGCATCAACCTC

TTCCTTGCGGAGCTGCTCTTCCTGGTTGGAATAGATAAAACTCAGTATGAG GTCGCCTGCCCTATCTTTGCGGGACTGCTGCACTACTTCTTCCTGGCC

GCCTTCTCCTGGCTGTGCCTGGAGGGCGTGCACCTCTACCTGTTGCTGGTGGAGGTGTTCGAGAGCGAGTATTCACGCACCAAGTACTATTACCTAGGTG

GCTACTGCTTCCCAGCCCTGGTGGTCGGCATCGCAGCAGCCATTGACTACCGAAGCTACGGCACTGAAAAGGC CTGCTGGCTGAGGGTGGATAACTACT

TCATCTGGAGCTTCATTGGGCCCGTCTCGTTTGTCATTGTG GTGAACCTGGTGTTCCTCATGGTGACCCTGCACAAGATGATCCGAAGCTCATCAGTGC

TCAAGCCTGACTCTAGTCGCCTTGACAACATCAA GTCCTGGGCGCTGGGTGCCATTGCACTGCTCTTCCTGCTGGGCCTCACCTGGGCTTTCGGCCTCC

TCTTCATCAACAAAGAGTCAGTAGTCATGGCCTATCTCTTCACTACCTTCAACGCCTTCCAGGGGGTCTTCATCTTTGTCTTTCACTGCGCCTTACAGAA

AAAG GTGCACAAGGAGTACAGCAAGTGCCTGCGTCACTCCTACTGCTGCATCCGCTCCCCACCTGGGGGCACTCACGGCTCCCTTAAGACCTCAGCCAT

GCGAAGTAACACCCGATACTACACAGGGACCCAG AGCCGAATCCGGAGGATGTGGAATGACACCGTGAGGAAGCAGACAGAGTCCTCCTTTATGGCAGG

TGACATCAACAGCACCCCCACCCTGAACCGAG GTACCATGGGGAACCACCTACTGACCAACCCCGTGCTACAGCCTCGTGGGGGCACTAGCCCATACAA

TACACTCATTGCAGAGTCCGTGGGCTTCAATCCCTCCTCGCCCCCAGTCTTCAACTCCCCAG GAAGCTACAGGGAACCCA AGCAAGCCTGCCCCTCAG

CCCCCAGAGTGCACCCAATGACCCCCCTCCCTTGGGGTGACTCCTGATGAAGCACAACTCCCCACAGGGCCCCTAACCCACTGGAGTGACCATATTTGGG

CAGTTCCCAGTCCTGTGGGCTGGGCTATCTGGGGAACAGATTTGGGGTCTGGGGCTCCCTGAGGAGTGGGTCCTGGGTTTGGATCTTTCTCTAGGGGGTC

CTCTTACCCCTCTCTCTTCCTCCCCTATTGCTGTAAATATTTCAACAAAATGG
Translation
 - UNI28072 - - UNI33695 - MARLAAALWSLCVTTVLVTSATQG - UNI26406 - - UNI28072 - GLSRAGLPFGLMRRELACEGYP

IELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQR - UNI18854 - RCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVP

YK - UNI18854 - KVEQKV VFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVAARHTTTYRLPNRVDG

TGFVVYDGAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTLRFEGTWETGYDKR

SASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSLAFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAG GPATSPPL

STTTTARPTPLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPAPSTRRPPAPNLHVSPELFCEPREVRRVQWPATQQGMLVERPCPKGTRG G

IASFQCLPALGLWNPRGPDLSNCTSPWVNQVAQK IKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAGKNYNK MH

KRERTCKDYIK AVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKQNVV VLEVTVLNTEGQVQELVFPQEYPSE

NSIQLSANTIKQNSRNG GVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGASLVVNSQVIAASINKESSRVFLMDPVIFTVAHLE AKNHFNANC

SFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTNFAVLMAHREI YQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCI

NLFLAELLFLVGIDKTQYE VACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKA ACWLR

VDNYFIWSFIGPVSFVIV VNLVFLMVTLHKMIRSSSVLKPDSSRLDNIK KSWALGAIALLFLLGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFV

FHCALQKK VHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNTRYYTGTQ SRIRRMWNDTVRKQTESSFMAGDINSTPTLNRG GTMGNHLLTNPVL

QPRGGTSPYNTLIAESVGFNPSSPPVFNSPG GSYREPK KQACPSAPRVHPMTPLPWGDS

For any suggestions or comments, please send an email to unitrap@crg.es