Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013089 (Etv5)
Chromosomal location
Chr 16: 22381385 - 22439691 (-)
Description
ets variant gene 5 Gene [Source:MGI Symbol;Acc:MGI:1096867]
RefSeq_dna
NM_023794 
RefSeq_peptide
NP_076283.2 
UniGene
Mm.155708 Mm.396072 Mm.409703 
MGI
MGI:1096867 
Uniprot/SWISSPROT
Q9CXC9 
Uniprot/SPTREMBL
Q8BJR1 
Human Ortholog
ENSG00000171656 (ETV5)
Omim not available
UniTrap UNI25115
Vector Insertion
Chr 16: 22436634 - 22439589
Public Clones D164C05 (ggtc)
Private Clones OST194772 (lexicon) OST181698 (lexicon) OST108269 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10400
Vector Insertion
Chr 16: 22436362 - 22436510
Public Clones W244B06 (ggtc) D073B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4752
Vector Insertion
Chr 16: 22436141 - 22436273
Public Clones AX0254 (sanger) D073C08 (ggtc) D063D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29874
Vector Insertion
Chr 16: 22421891 - 22436001
Public Clones (sanger) E038C11 (ggtc) D073C08 (ggtc) E039C09 (ggtc) CMHD-GT_540D1-5S (cmhd)
IST14904D1 (tigm) IST13272E11 (tigm) IST11577C7HMF1 (tigm) IST10917A12 (tigm)
IST10308B9 (tigm) IST11466B12 (tigm) IST14699B2 (tigm) IST10102C8 (tigm)
IST10102D1 (tigm) IST12917F2 (tigm) IST13247G8 (tigm) IST14445H5 (tigm)
IST14272F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13159
Vector Insertion
Chr 16: 22413048 - 22421891
Public Clones (sanger) E140D09 (ggtc) D104A10 (ggtc) 3SE142D02 (ggtc) D144F04 (ggtc)
D074C04 (ggtc) D136C08 (ggtc) D102F03 (ggtc) 5SE285F01 (ggtc) 5SE142D02 (ggtc)
E091E05 (ggtc) 3SE285F01 (ggtc) D139C04 (ggtc) D063D05 (ggtc) CMHD-GT_327A12-3 (cmhd)
IST11698C5 (tigm) IST12861E8 (tigm) IST14714A8 (tigm) IST12269B7 (tigm)
IST12433G1 (tigm) IST12289H10 (tigm) IST14916F7 (tigm) IST10660H10 (tigm)
IST12483F9 (tigm) IST14246C1 (tigm) IST12247E3 (tigm) IST10173C12 (tigm)
IST12615D2 (tigm) IST12544B4 (tigm) IST12417D5 (tigm) IST10081B11 (tigm)
IST12275H7 (tigm) IST10276G9 (tigm) IST10845F4 (tigm) IST10202A2 (tigm)
IST12533B7 (tigm) IST11401G12 (tigm)
Private Clones OST443036 (lexicon) OST430453 (lexicon) OST273865 (lexicon) OST257955 (lexicon)
OST63917 (lexicon) OST46073 (lexicon) OST46071 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12510
Vector Insertion
Chr 16: 22411994 - 22412917
Public Clones W183C03 (ggtc) CMHD-GT_344B11-3 (cmhd) IST12285A8 (tigm) IST10946B3 (tigm)
Private Clones OST440130 (lexicon) OST284475 (lexicon) OST251012 (lexicon) OST149115 (lexicon)
OST32089 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1985
Vector Insertion
Chr 16: 22402005 - 22411705
Public Clones (sanger) BC0611 (sanger) P147G08 (ggtc) H011B05 (ggtc) E023B07 (ggtc)
D078H03 (ggtc) E056G11 (ggtc) D160A03 (ggtc) M122H11 (ggtc) E049A04 (ggtc)
D107A11 (ggtc) E118E11 (ggtc) D177D04 (ggtc) D078G03 (ggtc) P106C08 (ggtc)
E056F11 (ggtc) D156A05 (ggtc) 3SE314F07 (ggtc) E059C03 (ggtc) D112B06 (ggtc)
CMHD-GT_519D12-3 (cmhd) PST19198-NR (escells) PST11869-NR (escells) IST14725F3 (tigm)
IST11730H11 (tigm) IST11026C7 (tigm) IST12695G12 (tigm) IST12306E2 (tigm)
IST10765B7 (tigm) IST14495D7 (tigm) IST14274A6 (tigm) IST11562B10 (tigm)
IST10065G1 (tigm) IST14654A7 (tigm) IST11272A6 (tigm) IST14294E3 (tigm)
IST12320D3 (tigm) IST14419C7 (tigm) IST14169G6 (tigm) IST14680C3 (tigm)
IST10834C8 (tigm) IST11549B7 (tigm)
Private Clones OST439426 (lexicon) OST438208 (lexicon) OST432700 (lexicon) OST417057 (lexicon)
OST416152 (lexicon) OST406405 (lexicon) OST385397 (lexicon) OST379196 (lexicon)
OST375230 (lexicon) OST372515 (lexicon) OST338792 (lexicon) OST338587 (lexicon)
OST320655 (lexicon) OST318620 (lexicon) OST318349 (lexicon) OST314585 (lexicon)
OST310450 (lexicon) OST262004 (lexicon) OST258292 (lexicon) OST251500 (lexicon)
OST250220 (lexicon) OST248079 (lexicon) OST237228 (lexicon) OST226518 (lexicon)
OST223846 (lexicon) OST223739 (lexicon) OST222758 (lexicon) OST218064 (lexicon)
OST215480 (lexicon) OST202232 (lexicon) OST202028 (lexicon) OST194715 (lexicon)
OST190651 (lexicon) OST186080 (lexicon) OST185625 (lexicon) OST182571 (lexicon)
OST181909 (lexicon) OST176257 (lexicon) OST175940 (lexicon) OST174226 (lexicon)
OST171885 (lexicon) OST166108 (lexicon) OST154011 (lexicon) OST152397 (lexicon)
OST132292 (lexicon) OST125945 (lexicon) OST124407 (lexicon) OST118827 (lexicon)
OST114231 (lexicon) OST98910 (lexicon) OST84700 (lexicon) OST84282 (lexicon)
OST69178 (lexicon) OST69032 (lexicon) OST38951 (lexicon) OST34601 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9709
Vector Insertion
Chr 16: 22399453 - 22401744
Public Clones (sanger) XG186 (baygenomics) D138C06 (ggtc) IST13438D6 (tigm) IST11553G4 (tigm)
IST13441H11 (tigm) IST14173D2 (tigm) IST14790C11 (tigm)
Private Clones OST439081 (lexicon) OST416158 (lexicon) OST379456 (lexicon) OST325420 (lexicon)
OST297666 (lexicon) OST203763 (lexicon) OST149558 (lexicon) OST129919 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16756
Vector Insertion
Chr 16: 22393129 - 22399392
Public Clones (sanger) IST12214E5 (tigm) IST14944H9 (tigm)
Private Clones OST454904 (lexicon) OST359755 (lexicon) OST311592 (lexicon) OST41006 (lexicon)
OST37101 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18586
Vector Insertion
Chr 16: 22392898 - 22393059
Public Clones CMHD-GT_476A3-3 (cmhd)
Private Clones OST420186 (lexicon) OST200219 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3376
Vector Insertion
Chr 16: 22386932 - 22392727
Public Clones XR0275 (sanger) AW0415 (sanger) XR0283 (sanger)
Private Clones OST398358 (lexicon) OST339457 (lexicon) OST211859 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14316
Vector Insertion
Chr 16: 22381384 - 22386932
Public Clones (sanger) FHCRC-GT-S20-11B1 (fhcrc)
Private Clones OST126647 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079601
Sequence
GCAGAGTCCGGAGGCCGGCGCGCAGAGCGGTCTTCATCCCCGATCGCTGCGGCCCAGCCCGCCACGGAGGCGCGCAGGCGGGCGCGCGGAGTGGCCGCTC

AG - UNI25115 - GAGTATCTCTTTACCACCCCCAAGAAACTACTCAATGCTGAAGCCCTTCAAAGTGATAGCGGAGACTTTGGAAGCACCATGGAT

GGGTTTTGTGATCAGCAAGTCCCTTTTATGGTCCCAGGG - UNI10400 - AAATCTCGATCAGAGGACTGTCGAGGGCGACCTTTGATTGACAGAAA

GAGGAAGTTTGTGGACACAGATCTGGCTCACGATTCTGAAG - UNI4752 - AGTTGTTTCAGGATCTTAGCCAGCTGCAGGAGGCTTGGTTAGCTGA

AG - UNI29874 - CACAAGTTCCTGATGATGAGCAGTTTGTCCCAGATTTTCAGTCTGATAACT - UNI13159 - - UNI29874 - TGGTGC

TTCATGCTCCACCTCCCACCAAGATCAAACGGGAGCTGCACAGCCCCTCCTCCGAGTTGTCGTCCTGTAGCCACGAGCAGGCTCTTGGTGCTAAGTATGG

AGAAAAGTGCCTCTACAACTATTG - UNI12510 - TGCCTACGATAGGAAGCCTCCCTCTGGGTTCAAGCCATTAACCCCGCCCGCCACTCCTCTGT

CACCCACCCATCAGAATTCCCTATTTCCCCCACCTCAGGCAACTCTGCCCACCTCAGGTCTCACCCCTGGAGCTGGCCCAGTTCAAGGGGTGGGTCCTGC

CCCGACTCCTCACTCACTTCCAGAACCTGGATCACAGCAACAAACATTTGCGGTCCCCCGGCCACCACATCAGCCCCTGCAAATGCCAAAGATGATGCCT

GAAAGCCAGTATCCATCAGAACAGAG - UNI1985 - ATTTCAGCGACAGCTGTCTGAGCCCAGCCATCCCTTCCCTCCTCAGTCAGGAGTTCCTGGA

GATAGTCGCCCCAGCTACCACCGGCAGATGTCAGAGCCCATTGTCCCCGCAGCTCCGCCACCCCTTCAGGGATTCAAGCAGGAATACCATGACCCACTGT

ATGAACATGGGGTCCCTGGGATGCCTGGTCCTCCAGCACATGGGTTCCAGTCACCCATGGGGATCAAGCAGGAGCCCCGAGATTACTGTGCTGACTCAG 

- UNI9709 - AAGTGCCTAACTGCCAGTCATCCTACATGAGAGGCGGGTATTTCTCCAGCAGCCATGAAG - UNI16756 - GATTCCCGTATGAG

AAGGACCCCAGGCTGTACTTTGATGATACTTGCGTGGTACCCGAGAGACTGGAAG - UNI18586 - GCAAAGTCAAGCAGGAGCCCACCATGTATCG

AGAGGGGCCTCCTTATCAGAGACGAGGCTCTCTGCAGCTGTGGCAGTTCCTTGTCACCCTCCTGGATGACCCAGCCAATGCCCACTTCATCGCCTGGACT

GGCCGAGGCATGGAATTTAAGCTCATAGAACCGGAAGAG - UNI3376 - - UNI14316 - GTTGCTCGCCGTTGGGGTATCCAGAAGAATCGGCC

AGCCATGAACTATGACAAGCTGAGCCGCTCTCTCCGCTATTACTATGAAAAGGGCATCATGCAGAAG - UNI14316 - GTGGCTGGGGAACGCTACG

TCTACAAATTTGTGTGTGACCCGGATGCACTCTTCTCTATGGCCTTCCCGGACAATCAGCGCCCGTTCCTGAAGGCAGAATCCGAATGCCCCCTCAATGA

GGAGGACACGCTGCCTCTGACTCACTTTGAAGACAACCCTGCTTACCTCCTGGACATGGATCGCTGCAGCAGCCTCCCCTACACCGAAGGCTTCGCTTAC

TAAGTTTCTGAATGGCCGAGTAGCCACACCCTAGAGCTAGCAGTCCTCATCCAGGCAACCGAGGGCAGTGGTTTTGTTTGTGTTCTTGGCTGTTCCTAAA

GCTTGCCCTTTGAGTATTATCAGGAGAACCCAAGCTGTCTCTGGATTCGACACCCTTTAAGACAAATACCTTGGCTCGGGAGGAGTGGGAACAGGGAGAG

ACAAAAACCACCACTTCCTGGGGAGACGTGGATACCGTCCTCCTTGCCACCATGGCCAGTATGTGCAGAGCAGTACTGCAGTGTGTTCAGGGTTAGCGCC

CATGAAAGGGGACCGAGTGTATGACAATCTGCGTTGATCATGGACTACTAAAATGCCTTCACACAGGAGGCTTTGACTTGCACAATTCTTTGGGAAGAAA

CTGCACACCCATAGGACAGTCGATAAGGCTGAGTCGGGGAGGCTCAGACCATTGAGGCTTGAAATTGCAAAACTCTTGTAGCTCATTCTGAAATCTTTCC

CCTGTAGTCCAGAACTGGGGAGGCCAGGAGAGCCGTTACTCACTCCATGGCTCTCAGACCGCGTTCCTCTTTGGCCTTCCTTCCAGCCGAGCCGTCACCA

TAAGTAAATCAAGTCCCTTCCTCCCAGTCACACGGCTGAGCGCAGACGGCTTGTTTTAAAAAGATGATGAACATGACAGTATTTTGTTTTGCTTTGATTT

GGGGGGGAAGGGTTCATCTTGCTTTTGGAGGTTGTTTTGGGGAAAAAACAGTTTATATAAACTGATTTTTGTAGTTTTGGTATTTAAAGCAAAAACAAAC

AAAAAACAAACCCCTTTTTGGTACCTGCACTGCATCCCTCGGGTGGGGCAGTGCCTACTTTGGAAGATGCTGCAGCCTGCGAGGGGATCTGCTGGGGCTT

CCCCTTCGCCACACAGAAGCCTGCTTAGTGCTTTCTGCACCAGACAACCTGTTGAGGCGTATAACCTGATCTGTACATTTTTTTAAGTGTGCAGGGCAGC

CTGGACACAGCTTAGCGTTCTACGTGTATAGTTCTCCATGCTCACTAACTCTCCTTCTCTGGGAAGCAGATGTACATACTACATACATGTCACATACTAC

ATACATGTCATGTACTACACACATGTCATATAGTACATACATGTCATGTCCATTTAACGACTGGTCACCTGCTGGGGACCCAGGCATCTGCCTTGTTTTC

CTTTTTCTTTCAGTTTTGGACTTTGGACCCTGCACAGCCGTTCCCCAGGGTCTGAAACTTACCTGTCACGCACAGGTAGAGCAGTGCTAGCTAGCATTAC

TGGCTTCCTGCTACTTTTTCGTTTTTTTAAATTTTTTATTCTGATTGCTGTATTATATTGGGGATGTTCTAAACAACCAAACTAAAGCTGTGTACAGATT

GGGTTTGGAGCGGTGGGGACGTCAGCAGGAAACGCCAGTGCTTTGCTGCCTGATTGACAGGAATTTGCTGTCCTTGACACTCCACACATTGTGTTCCTCA

CGTGTGGGACAGGACACAGAGCTGACTGAGCGTGGGACACTCCACAGCCTTCTCATGACTTGTGAAGGAGGTTCACAGGAACGAGGGGTATGTTTTAGAG

CTATGAGAACCTAGTCAGCCCACAGAGGCGTCAAACCTGAAGCTTGGGCCTTAATTAGCATTGTACTCTGATGAAAGGACTCTTTCATAAGCATATTTAT

AGCTTTCTAATCTATACACAGTCTATCCATAGATGCATATTTTACCCCAACTGGCTAGAGATTTATTTGTTGTAAATGCTGTATAGATTTTGGGTTTTTT

TTTTTTGTTCTTCCTCTCTTCACTTATACTGGTGTGGGGTTTGTTTTAGTTTTCTTTAGTGAATTTATGCTGTTTTGGGGGGCGGATTGAGAAGAATCTT

CCGTAGCCTGAGCTGTCCCTCCTGTTTTGACGGCACATGTGCCAGTCAAGGGACATGGGACAGTCGCGCCACTTTGCATTCCCACGGGACTCATGTACCT

CCCGCAGAGCCGTCCCCGTCAAGGTGTGGGGCTCCTTTCATGCATTTGCTTCTTTTCCAGAGTGTGGATTTGAACTACTTCCCCCTGCAAAGGGCCGCGT

GCACCCTGCCGAGCTGCGTATATTCTGTACTGTGTACAATAAAGAAGATTGCTTTCCTTAC
Translation
 - UNI25115 - MDGFCDQQVPFMVPG - UNI10400 - KSRSEDCRGRPLIDRKRKFVDTDLAHDSEE - UNI4752 - ELFQDLSQLQEAWL

AEA - UNI29874 - AQVPDDEQFVPDFQSDNL - UNI13159 - - UNI29874 - LVLHAPPPTKIKRELHSPSSELSSCSHEQALGAKYGEK

CLYNYC - UNI12510 - CAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPTSGLTPGAGPVQGVGPAPTPHSLPEPGSQQQTFAVPRPPHQP

LQMPKMMPESQYPSEQR - UNI1985 - RFQRQLSEPSHPFPPQSGVPGDSRPSYHRQMSEPIVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGF

QSPMGIKQEPRDYCADSE - UNI9709 - EVPNCQSSYMRGGYFSSSHEG - UNI16756 - GFPYEKDPRLYFDDTCVVPERLEG - UNI1858

6 - GKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEE - UNI3376 - - UNI14316 - VARRWGIQKNRPA

MNYDKLSRSLRYYYEKGIMQK - UNI14316 - VAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECPLNEEDTLPLTHFEDNPAYLLDMDRCSSL

PYTEGFAY
Transcript ENSMUST00000051229
Sequence
GCAGAGTCCGGAGGCCGGCGCGCAGAGCGGTCTTCATCCCCGATCGCTGCGGCCCAGCCCGCCACGGAGGCGCGCAGGCGGGCGCGCGGAGTGGCCGCTC

AG - UNI25115 - GAGTATCTCTTTACCACCCCCAAGAAACTACTCAATGCTGAAGCCCTTCAAAGTGATAGCGGAGACTTTGGAAGCACCATGGAT

GGGTTTTGTGATCAGCAAGTCCCTTTTATGGTCCCAGGG - UNI10400 - AAATCTCGATCAGAGGACTGTCGAGGGCGACCTTTGATTGACAGAAA

GAGGAAGTTTGTGGACACAGATCTGGCTCACGATTCTGAAG - UNI4752 - AGTTGTTTCAGGATCTTAGCCAGCTGCAGGAGGCTTGGTTAGCTGA

AG - UNI29874 - CACAAGTTCCTGATGATGAGCAGTTTGTCCCAGATTTTCAGTCTGATAACT - UNI29874 - GCTCTCTGTCTGACGAAGC

TGGACCTCACCGGTTGGCTAGAGCCGGGACTGCAG - UNI13159 - - UNI29874 - TGGTGCTTCATGCTCCACCTCCCACCAAGATCAAACGG

GAGCTGCACAGCCCCTCCTCCGAGTTGTCGTCCTGTAGCCACGAGCAGGCTCTTGGTGCTAAGTATGGAGAAAAGTGCCTCTACAACTATTG - UNI12

510 - TGCCTACGATAGGAAGCCTCCCTCTGGGTTCAAGCCATTAACCCCGCCCGCCACTCCTCTGTCACCCACCCATCAGAATTCCCTATTTCCCCCA

CCTCAGGCAACTCTGCCCACCTCAGGTCTCACCCCTGGAGCTGGCCCAGTTCAAGGGGTGGGTCCTGCCCCGACTCCTCACTCACTTCCAGAACCTGGAT

CACAGCAACAAACATTTGCGGTCCCCCGGCCACCACATCAGCCCCTGCAAATGCCAAAGATGATGCCTGAAAGCCAGTATCCATCAGAACAGAG - UNI

1985 - ATTTCAGCGACAGCTGTCTGAGCCCAGCCATCCCTTCCCTCCTCAGTCAGGAGTTCCTGGAGATAGTCGCCCCAGCTACCACCGGCAGATGTC

AGAGCCCATTGTCCCCGCAGCTCCGCCACCCCTTCAGGGATTCAAGCAGGAATACCATGACCCACTGTATGAACATGGGGTCCCTGGGATGCCTGGTCCT

CCAGCACATGGGTTCCAGTCACCCATGGGGATCAAGCAGGAGCCCCGAGATTACTGTGCTGACTCAG - UNI9709 - AAGTGCCTAACTGCCAGTCA

TCCTACATGAGAGGCGGGTATTTCTCCAGCAGCCATGAAG - UNI16756 - GATTCCCGTATGAGAAGGACCCCAGGCTGTACTTTGATGATACTTG

CGTGGTACCCGAGAGACTGGAAG - UNI18586 - GCAAAGTCAAGCAGGAGCCCACCATGTATCGAGAGGGGCCTCCTTATCAGAGACGAGGCTCTC

TGCAGCTGTGGCAGTTCCTTGTCACCCTCCTGGATGACCCAGCCAATGCCCACTTCATCGCCTGGACTGGCCGAGGCATGGAATTTAAGCTCATAGAACC

GGAAGAG - UNI3376 - - UNI14316 - GTTGCTCGCCGTTGGGGTATCCAGAAGAATCGGCCAGCCATGAACTATGACAAGCTGAGCCGCTCTC

TCCGCTATTACTATGAAAAGGGCATCATGCAGAAG - UNI14316 - GTGGCTGGGGAACGCTACGTCTACAAATTTGTGTGTGACCCGGATGCACTC

TTCTCTATGGCCTTCCCGGACAATCAGCGCCCGTTCCTGAAGGCAGAATCCGAATGCCCCCTCAATGAGGAGGACACGCTGCCTCTGACTCACTTTGAAG

ACAACCCTGCTTACCTCCTGGACATGGATCGCTGCAGCAGCCTCCCCTACACCGAAGGCTTCGCTTACTAAGTTTCTGAATGGCCGAGTAGCCACACCCT

AGAGCTAGCAGTCCTCATCCAGGCAACCGAGGGCAGTGGTTTTGTTTGTGTTCTTGGCTGTTCCTAAAGCTTGCCCTTTGAGTATTATCAGGAGAACCCA

AGCTGTCTCTGGATTCGACACCCTTTAAGACAAATACCTTGGCTCGGGAGGAGTGGGAACAGGGAGAGACAAAAACCACCACTTCCTGGGGAGACGTGGA

TACCGTCCTCCTTGCCACCATGGCCAGTATGTGCAGAGCAGTACTGCAGTGTGTTCAGGGTTAGCGCCCATGAAAGGGGACCGAGTGTATGACAATCTGC

GTTGATCATGGACTACTAAAATGCCTTCACACAGGAGGCTTTGACTTGCACAATTCTTTGGGAAGAAACTGCACACCCATAGGACAGTCGATAAGGCTGA

GTCGGGGAGGCTCAGACCATTGAGGCTTGAAATTGCAAAACTCTTGTAGCTCATTCTGAAATCTTTCCCCTGTAGTCCAGAACTGGGGAGGCCAGGAGAG

CCGTTACTCACTCCATGGCTCTCAGACCGCGTTCCTCTTTGGCCTTCCTTCCAGCCGAGCCGTCACCATAAGTAAATCAAGTCCCTTCCTCCCAGTCACA

CGGCTGAGCGCAGACGGCTTGTTTTAAAAAGATGATGAACATGACAGTATTTTGTTTTGCTTTGATTTGGGGGGGAAGGGTTCATCTTGCTTTTGGAGGT

TGTTTTGGGGAAAAAACAGTTTATATAAACTGATTTTTGTAGTTTTGGTATTTAAAGCAAAAACAAACAAAAAACAAACCCCTTTTTGGTACCTGCACTG

CATCCCTCGGGTGGGGCAGTGCCTACTTTGGAAGATGCTGCAGCCTGCGAGGGGATCTGCTGGGGCTTCCCCTTCGCCACACAGAAGCCTGCTTAGTGCT

TTCTGCACCAGACAACCTGTTGAGGCGTATAACCTGATCTGTACATTTTTTTAAGTGTGCAGGGCAGCCTGGACACAGCTTAGCGTTCTACGTGTATAGT

TCTCCATGCTCACTAACTCTCCTTCTCTGGGAAGCAGATGTACATACTACATACATGTCACATACTACATACATGTCATGTACTACACACATGTCATATA

GTACATACATGTCATGTCCATTTAACGACTGGTCACCTGCTGGGGACCCAGGCATCTGCCTTGTTTTCCTTTTTCTTTCAGTTTTGGACTTTGGACCCTG

CACAGCCGTTCCCCAGGGTCTGAAACTTACCTGTCACGCACAGGTAGAGCAGTGCTAGCTAGCATTACTGGCTTCCTGCTACTTTTTCGTTTTTTTAAAT

TTTTTATTCTGATTGCTGTATTATATTGGGGATGTTCTAAACAACCAAACTAAAGCTGTGTACAGATTGGGTTTGGAGCGGTGGGGACGTCAGCAGGAAA

CGCCAGTGCTTTGCTGCCTGATTGACAGGAATTTGCTGTCCTTGACACTCCACACATTGTGTTCCTCACGTGTGGGACAGGACACAGAGCTGACTGAGCG

TGGGACACTCCACAGCCTTCTCATGACTTGTGAAGGAGGTTCACAGGAACGAGGGGTATGTTTTAGAGCTATGAGAACCTAGTCAGCCCACAGAGGCGTC

AAACCTGAAGCTTGGGCCTTAATTAGCATTGTACTCTGATGAAAGGACTCTTTCATAAGCATATTTATAGCTTTCTAATCTATACACAGTCTATCCATAG

ATGCATATTTTACCCCAACTGGCTAGAGATTTATTTGTTGTAAATGCTGTATAGATTTTGGGTTTTTTTTTTTTGTTCTTCCTCTCTTCACTTATACTGG

TGTGGGGTTTGTTTTAGTTTTCTTTAGTGAATTTATGCTGTTTTGGGGGGCGGATTGAGAAGAATCTTCCGTAGCCTGAGCTGTCCCTCCTGTTTTGACG

GCACATGTGCCAGTCAAGGGACATGGGACAGTCGCGCCACTTTGCATTCCCACGGGACTCATGTACCTCCCGCAGAGCCGTCCCCGTCAAGGTGTGGGGC

TCCTTTCATGCATTTGCTTCTTTTCCAGAGTGTGGATTTGAACTACTTCCCCCTGCAAAGGGCCGCGTGCACCCTGCCGAGCTGCGTATATTCTGTACTG

TGTACAATAAAGAAGATTGCTTTCCTTAC
Translation
 - UNI25115 - MDGFCDQQVPFMVPG - UNI10400 - KSRSEDCRGRPLIDRKRKFVDTDLAHDSEE - UNI4752 - ELFQDLSQLQEAWL

AEA - UNI29874 - AQVPDDEQFVPDFQSDNC - UNI29874 - CSLSDEAGPHRLARAGTAV - UNI13159 - - UNI29874 - VVLHA

PPPTKIKRELHSPSSELSSCSHEQALGAKYGEKCLYNYC - UNI12510 - CAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPTSGLTPGAG

PVQGVGPAPTPHSLPEPGSQQQTFAVPRPPHQPLQMPKMMPESQYPSEQR - UNI1985 - RFQRQLSEPSHPFPPQSGVPGDSRPSYHRQMSEPIVP

AAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCADSE - UNI9709 - EVPNCQSSYMRGGYFSSSHEG - UNI16756 - G

FPYEKDPRLYFDDTCVVPERLEG - UNI18586 - GKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEE - UNI

3376 - - UNI14316 - VARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQK - UNI14316 - VAGERYVYKFVCDPDALFSMAFPDNQRPFLKA

ESECPLNEEDTLPLTHFEDNPAYLLDMDRCSSLPYTEGFAY

For any suggestions or comments, please send an email to unitrap@crg.es