Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013150 (Gfod2)
Chromosomal location
Chr 8: 108240013 - 108282507 (-)
Description
glucose-fructose oxidoreductase domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1917825]
RefSeq_dna
NM_027469 
RefSeq_peptide
NP_081745.1 
UniGene
Mm.40954 
MGI
MGI:1917825 
Uniprot/SWISSPROT
Q9CYH5 
Human Ortholog
ENSG00000141098 (GFOD2)
Omim not available
UniTrap UNI30261
Vector Insertion
Chr 8: 108251887 - 108282508
Public Clones D054E06 (ggtc) IST10524A6 (tigm) IST14206G6 (tigm) IST12427H12 (tigm)
IST12421F12 (tigm) IST11825B1 (tigm) IST12810G1 (tigm) IST14623C2 (tigm)
IST15059D11 (tigm) IST10885F3 (tigm) IST12646C2 (tigm) IST12485H6 (tigm)
IST11825B2 (tigm) IST13960F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23119
Vector Insertion
Chr 8: 108241551 - 108251887
Public Clones IST12122C4 (tigm) IST13091A12 (tigm) IST13852D4 (tigm) IST12466A12 (tigm)
IST14740E8 (tigm) IST13693B11 (tigm)
Private Clones OST275800 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000013294
Sequence
AGAAACCAGGCGGCGTGTTCCCGGTATCGGTGCTTTGGATTCCGGCGCGCGCGCATCCGCACTAGCCTCCCTCAGGGCAGGCGGACGGCCTCGGAAACCC

CTCCGGATCCATGGTCTCTCGTGCAGCTCTGGGCGGGCAATGCCAGCATGCCAG - UNI30261 - GAGCCATGTTTGATCAGGATGACGGGACGGTC

AGCTGCATCCCGGGGACCCTTGTAAGGACATGAGTGCTTGAGCAGAGGCCAGGATGAAGCTGCTCCCAGGAGTCGGTGTGTTCGGGACTGGCAGCTCAGC

CCGGGTCCTGGTCCCGCTGCTGAGGGCAGAGGGCTTCACCGTGGAGGCCCTGTGGGGGAAGACTGAGGAAGAGGCAAAGCAGCTGGCCGAGGAGATGAAC

ATCACCTTCTACACCAGCCGCACAGACGACGTCTTGCTGCATCAAGACGTAGACCTGGTCTGCATCAACATCCCACCTCCGCTCACCCGGCAGATATCCG

TGAAGGCTCTAG - UNI23119 - - UNI30261 - GAATTGGGAAGAACGTGGTGTGTGAGAAGGCAGCGACATCCATGGACGCCTTCCGGATGGT

GACCGCATCTCGCTACTACCCACAGCTGATGAGCTTGGTGGGGAACGTTCTGCGCTTCCTGCCTGCCTTCGTGCGCATGAAACAGCTCATTGCAGAGCAC

TACGTGGGTGCCGTGATGATCTGCGACGCTCGCATCTACTCCGGGAGCCTGCTCAGCCCCAGCTACGGCTGGATCTGTGACGAGCTTATGGGGGGCGGGG

GCCTGCACACCATGGGTACCTATATCGTGGACCTGTTGACCCACTTGACTGGCCAGAAAGCCGAGAAGGTGCACGGGCTCCTCAAGACCTTTGTGAGGCA

GAATGCCACCATCCGTGGCATCCGCCATGTCACCAGTGATGACTTCTGTTTTTTCCAGATGCTCATGGGTGGGGGGGTATGCAGCACAGTGACCCTCAAC

TTCAACATGCCAGGTGCCTTTGTGCATGAGGTCATGGTAGTGGGCTCCGCAGGGCGCCTTGTTGCCCGGGGAGCTGACCTCTATGGGCAGAAGAACTCTG

CTGCACAGGAGGAGCTGCTGGTGAGAGACTCTCTGGCTGTGGGCGCAGGGCTCCCTGAGCAAGGTCCCCAGGATGTCCCACTGCTTTACTTGAAAGGTAT

GGTCTATATGGTTCAGGCCTTGCGTCAGTCCTTCCAGGGGCAGGGGGATCGCCGTACCTGGGACCGCACCCCTGTCTCTATGGCTGCCTCATTCGAGGAC

GGACTGTATATGCAGAGCGTGGTAGATGCTATTAAAAGGTCCAGCCGGTCTGGGGAGTGGGAGACTGTGGAGATGCTGGCAGAGGAGCCAGATGCCAACC

AGAATCTAAGTGAAACACTTCAGCGGAACAACCTGTGAACCTGCGCATGCGCGCTTCCTCCCAAGGGCCAGAGGCTCCAGGGAGGGCACTGGGACCTGGG

ATTGGCTGTAGCAGAGACACGGTGTCGTTTTTTAAATAAATCAGCTTGGGCCAGGGTTAGGAGCCAACTGAAGGTGGCCAAGGAAAACACCCATCCATCC

ATCATTGATTCCTCAGACTTGCCTGGGGACCCCTAGCTATGACGCACCTGCTGTCATAGCTTAGGCTAGCAGTGTGTGCAGGATAGAGCTGTAGCCTGAC

CCCTTGTGGTTCTGCCAGTGAGCAGGGCCAATGAAGATCAATATGGGCTCTTCAGGCTGAGTTGTGGTCTCACAGGATGAGAAAACCCAACAGGAACTAG

CTTGGTTGAGTCCTTAGGGTAGATGGCAAGAAACCTTGCCTGTTGTGGACCAGGGCATCTCAGGACTGGAGAAGGCGGTGACAGGTCATCCCTTAGGGAT

CTTCCCCCACCCTCCCATTCGATCTGATCTTTTCAGCCCCCTTGCAAGCCCTTCCAAGAGAAAAGGAGGTTTCTGTGTTATACATAACTCTGGGGGGGGG

GGGCAACTTGGCAGAGAGAAGACAAAGGGGAACTGTAGAACATCTGAGAAATGTCAGTAAATAAGTCAGAAAAGAAC
Translation
 - UNI30261 - MKLLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNITFYTSRTDDVLLHQDVDLVCINIPPPLTRQISVKAL

G - UNI23119 - - UNI30261 - GIGKNVVCEKAATSMDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLL

SPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAG

RLVARGADLYGQKNSAAQEELLVRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSG

EWETVEMLAEEPDANQNLSETLQRNNL

For any suggestions or comments, please send an email to unitrap@crg.es