Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013155 (E130303B06Rik)
Chromosomal location
Chr 8: 108227553 - 108232090 (-)
Description
RIKEN cDNA E130303B06 gene Gene [Source:MGI Symbol;Acc:MGI:2142593]
RefSeq_dna
NM_198299 
RefSeq_peptide
NP_938041.1 
MGI
MGI:2142593 
Uniprot/SWISSPROT
Q7TSV9 
Human Ortholog
ENSG00000124074 (C16orf48)
Omim not available
UniTrap UNI21726
Vector Insertion
Chr 8: 108230639 - 108231448
Public Clones not available
Private Clones OST319697 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22471
Vector Insertion
Chr 8: 108227922 - 108228012
Public Clones not available
Private Clones OST296194 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000013299
Sequence
CCGGCTTGCAACAGTTGGCGGTAAAACTGCTCCAGTGAGAGCCCTCGCTGGGGCTTGGCGGGGGAGGGGCGGCGAACCCCTCTGGGCAGTGGGCTAGTCG

CGGGGCGGTGGTACAGTCTGCGCCTAGAGACGGGCGGTCGTCGAGGGGTGGGGCTCGGTGATGGGGGCTACCGCGGGGATGCAGGGCTCGGGTGGAGGGT

GGAAGCACCCGACAGGGATTAGAGGGGAAAGTTGCGCAGCGCAACAGGCCCTGGTGCACTGTTGCAGGGCTGCGGTAGGATCATGTGCGAGGGCCCGTCC

CGCATCTCTGGACCCATCCCCCCAGACCCCACTCTCTGCCCGGACTACTACCGGCGGCCGGCCTCGG CCCAAGGACGCCTGGAAGGAAACGCGTTGAAG

CTGGACCTGCTGACTTCAGGTCGGGACCTGGACTCCAGTCCTCCTCGTGGCCCTCGCATCAGGCCTGAAGCCCGAGAGATCCTAGAGCGTGGCCAGCGAG

GCGTGGGGGACGTGCTGCTGCAACTGGGGTGCATCTCCCTCGGTTCGGGGGTCTCTCCTAAGA - UNI21726 - GGAAGAATCCAAAGGACCATGAG

AAGGAAAACTTGAGGCGGATCAAAGAGATTCAGAGGCGCTTCCAAGACCAGGAACGCAGCCGGGAACAGGGTCAGCCTAAGCCACTGAAGGCACTGTGGC

GCTCACCCAAGTATGACAATGTGGAGTCTCGAGTCAAGGCCAGGATGAAG GAGCTTGGCCCCACCTCTGTGACAGAACCTGCCCACTTTCTGCGGGCAC

ACTCCCGCTGTGGCCCTGGGCTCCCACCATCCCGTGCCTCCAGTCCTCAGCTCGCCCTTCCAGGTCCCCAAGCTAAG GGACCCGGCCTAGGCGTGGATT

TCATTAGTCGCAACGCCCTAGCTGCCAAGAGAGCCCCCCGGCGCCACTCCCGCTCCCTGCAGGTCCTTGCACAGGTTCAGGAACAGCAGCGCCAAGCCCA

GGAGCGCTACAACGCCACGCAGAAAGGCCATGTGCCCCATTA CTTGTTGGAACGCAGGGACCTGTGGCGGAAGGAAGCGGAAGCTCGCCAGCGTAGCCA

GCCAGACCCGTCCATGCCCCCGGGCCACACACTCATGCCTGAGAATCAGCGGCTGGAGACCCTGAACAATCTGCTACAAA - UNI22471 - GCCAGA

GCCAGCTGCTACGTGAGCTAGTACTATTACCTGCTGGGGCAGACTCGCTGAGAGCCCAGGGTCATCGTGCTGAACTGGACCGGAAGTTGGTGCAAATAGA

AGAGGCTATCAAGATCTTTTCCCGACCCAAAGTCTTTGTGAAGATGGATACCTAGTCCTTCCCCGCTTGGTACCCACCAAGAGTAACAGGGAGATATGTG

TGCGGATCACCACGTGGCTGCCAAGGGCAGACTCAAGCCCTGTCATAGCTCAAAGACAGGAGCGTTGGGGTGGGCAGAATCGAAAGCACTTCTTAGTCAC

CAGGGGCTGCAGAAGGGCCACCAGCCTCCCAACTTCTCTGTCAAAATTAAACCTTTTGTACAC
Translation
MCEGPSRISGPIPPDPTLCPDYYRRPASA AQGRLEGNALKLDLLTSGRDLDSSPPRGPRIRPEAREILERGQRGVGDVLLQLGCISLGSGVSPKR - U

NI21726 - RKNPKDHEKENLRRIKEIQRRFQDQERSREQGQPKPLKALWRSPKYDNVESRVKARMK ELGPTSVTEPAHFLRAHSRCGPGLPPSRASS

PQLALPGPQAK GPGLGVDFISRNALAAKRAPRRHSRSLQVLAQVQEQQRQAQERYNATQKGHVPHY YLLERRDLWRKEAEARQRSQPDPSMPPGHTLM

PENQRLETLNNLLQS - UNI22471 - SQSQLLRELVLLPAGADSLRAQGHRAELDRKLVQIEEAIKIFSRPKVFVKMDT

For any suggestions or comments, please send an email to unitrap@crg.es