Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013160 (Atp6v0d1)
Chromosomal location
Chr 8: 108048370 - 108089909 (-)
Description
ATPase, H+ transporting, lysosomal V0 subunit D1 Gene [Source:MGI (curated);Acc:Atp6v0d1-001]
RefSeq_dna
NM_013477 
RefSeq_peptide
NP_038505.2 
UniGene
Mm.17708 Mm.462635 
MGI
MGI:1201778 
Uniprot/SWISSPROT
P51863 
Uniprot/SPTREMBL
Q921S5 
Human Ortholog
ENSG00000159720 (ATP6V0D1)
Omim not available
UniTrap UNI22766
Vector Insertion
Chr 8: 108063393 - 108089682
Public Clones E050F06 (ggtc) CMHD-GT_426H4-3 (cmhd) CMHD-GT_545H2-3 (cmhd) IST12373H12 (tigm)
Private Clones OST285299 (lexicon) OST68988 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000013304
Sequence
AGCTGATCCGGGGAGTCTAGTTGCGTGCGGGCAGATCGGGGCTCTCTGGTCCCGCCGCCCCCCGCCTCCCCTGCCGCCTCCCACCCCCGCCGCAGCCATG

TCGTTCTTCCCGGAGCTCTATTTCAACGTGGACAATGGCTACTTGGAGGGATTAGTGCGCGGCCTGAAGGCCGGGGTGCTCAGCCAGGCGGACTACCTCA

ACCTGGTGCAGTGCGAGACGCTCGAGG - UNI22766 - ACTTGAAGCTGCACCTACAGAGTACAGATTATGGCAACTTCCTGGCCAATGAAGCGTCA

CCTCTGACGGTGTCAGTCATCGATGACAAGCTCAAGGAGAAGATGGTAGTAGAGTTCCGCCACATGAGAAACCATGCTTATGAGCCGCTCGCCAGCTTCC

TGGACTTCATAAC TTATAGCTACATGATTGACAACGTGATCCTGCTAATCACAGGCACACTGCACCAGCGTTCAATAGCTGAACTTGTGCCCAAGTGCC

ATCCGCTAGGCAGCTTTGAGCAGATGGAGGCTGTGAACATCGCACAGACACCTGCAGAGCTCTACAATGCCATTCTGGTGGACACACCCCTGG CGGCTT

TTTTCCAGGACTGCATCTCAGAGCAGGACCTTGATGAGATGAACATCGAGATAATCCGAAATACGCTTTACAAG GCCTACTTGGAGTCCTTCTACAAGT

TCTGTACTCTGTTGGGTGGGACCACAGCTGATGCCATGTGTCCTATCCTAGAG TTTGAAGCAGACCGCCGCGCTTTCATCATCACCATCAACTCTTTCG

GCACAGAGCTGTCCAAGGAGGACCGTGCCAAGCTCTTCCCGCACTGTGGCCGGCTCTACCCTGAGGGCTTGGCTCAGCTGGCGCGGGCTGATGACTATGA

ACAGGTCAAGAATGTAGCTGATTACTACCCG GAATACAAACTGCTTTTTGAGGGTGCAGGTAGCAATCCTGGAGACAAGACCCTGGAGGACCGGTTTTT

TGAACATGAG GTGAAGCTAAACAAGCTGGCCTTCCTGAACCAGTTCCATTTTGGTGTCTTTTATGCCTTTGTGAAGCTTAAGGAACAGGAATGTCGCAA

CATCGTATGGATTGCTGAGTGCATTGCCCAGCGCCATCGCGCCAAGATCGACAACTACATCCCCATCTTTTAGCATTCTAACTTAAGGTTCCCAAGTGCA

CTGTGTGTGTGTCTGTGTGCTGTGGTGAAGCCCAGGGCTCACTTGTCTGACCTGGTGAGGTGTAGCATTGTCCTGGGATTGTTTGCCCAGCTTCCATGAC

CCCTTCTGGGACTACTCTTAGGCCTAAAAAGGGGTTAGGCACCTCTCCCCTGATCAAGAATGGACCAAGATTCCCTCCAGAGCAGAGAGGCCCCCAGCCC

TATGTTTACAGCCACTGACATGTCTAAGAAACTTGTATGACTTTCATGTCCCTCCTTAGCCTAAGGACCCCTGGGACAGTGTCCATAGGTCATCCCCAGA

ACCTGTGGGAAGAGTAGAGAATATGTATTCTTGGGGTATTGGGAAAGCAGCTTTGTAGCCTTCTCCCTCCGCTCTGCCCCTCTGAGACAATAAAATTGCC

CTCTTT
Translation
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLED - UNI22766 - DLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHM

RNHAYEPLASFLDFIT TYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLA AAFFQDCISEQDLDEMNIEII

RNTLYK AYLESFYKFCTLLGGTTADAMCPILE FEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYP EYKLLF

EGAGSNPGDKTLEDRFFEHE VKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

For any suggestions or comments, please send an email to unitrap@crg.es