Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013418 (B4galnt2)
Chromosomal location
Chr 11: 95724873 - 95776185 (-)
Description
beta-1,4-N-acetyl-galactosaminyl transferase 2 Gene [Source:MGI (curated);Acc:B4galnt2-001]
RefSeq_dna
NM_008081 
RefSeq_peptide
NP_032107.1 
UniGene
Mm.340702 
MGI
MGI:1342058 
Uniprot/SWISSPROT
Q09199 
Uniprot/SPTREMBL
A2A615 Q9Z2F4 
Human Ortholog
ENSG00000167080 (B4GALNT2)
Omim not available
UniTrap UNI31544
Vector Insertion
Chr 11: 95753657 - 95776186
Public Clones IST10885C11 (tigm) IST12709B4 (tigm) IST12658G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25390
Vector Insertion
Chr 11: 95752425 - 95753071
Public Clones not available
Private Clones OST185685 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18688
Vector Insertion
Chr 11: 95735263 - 95737411
Public Clones (cmhd)
Private Clones OST417733 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37265
Vector Insertion
Chr 11: 95730736 - 95735175
Public Clones CMHD-GT_460A4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34473
Vector Insertion
Chr 11: 95724872 - 95728284
Public Clones IST12392E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038343
Sequence
CTGCGGTAGGCAGTCTGCAGAAGTGGCTGGAGCGAGCTGCGATGACTTCCAG - UNI31544 - CGTGTCTTTTGCCAGCTTCAGGTTTCCATGGCTC

CTCAAGACATTTGTCCTCATGGTAGGACTTGCCACTGTTGCGTTTATGGTGAGAAAGGTGTCCCTTACAACAGACTTCAGCACCTTCAAGCCAAAGTTTC

CAGAGCCTGCAAGGGTTGACCCAGTGCTGAAGCTTCTACCAGAGGAGCATCTGAGGAAACTCTTTACCTACAGTGACATCTG - UNI25390 - GCTC

TTCCCCAAAAATCAGTGTGACTGTAACTCTGGCAAACTGCGAATGAAATATAAGTTTCAGGATGCCTATAACCAGAAGGACCTTCCAGCTGTGAATGCCA

GAAGACAGGCAGAATTTGAGCACTTTCAGAGGAG AGAAGGGCTGCCTCGCCCACCACCTCTGCTGGCTCCACCCAATCTCCCCTTCGGATACCCAGTCC

ATGGTGTGGAGGTGATGCCCCTGCATACAATTCTCATCCCAG GCCTCCAGTATGAAGGGCCAGATGCTCCAGTCTATGAG GTCATCCTGAAAGCTTCT

CTGGGGACACTGAACACCCTTGCTGATGTGCCAGATGATGAGGTTCAGGGCAGAGGCCAGAGGCAGCTGACCATTTCCACCAGACATCGGAAGGTCCTGA

ATTTCATCCTTCAGCATGTGACGTACACCAGCACAGAGTACTATCTCCACAAGGTGGACACAG - UNI18688 - TAAGTATGGAATACGAGTCGTCA

GTGGCCAAGTTTCCAGTGACTATCAAACAACAGACTGTACCCAAGTTGTATGACCCTGGACCTG AGAGGAAGATCAGAAACCTGGTGACCATTGCCACG

AAGACTTTTCTCCGTCCCCACAAGCTTAAGATCCTGCTTCAGAGTATTCGAAAATATTACCCAGACATCACCGTGATTGTAGCTGATGACAGCAAGGAGC

CCCTGGAAATTAATGATGACTACGTGGAGTACTACACCATGCCCTTTGGGAAG GGCTGGTTTGCTGGGAGGAACCTGGCCATCTCACAGGTGACTACTA

AATATGTCCTCTGGGTGGACGATGACTTTCTCTTCAGCGACAAGACCAAGATTGAGGTACTGGTGGATGTCCTGGAGAAAACCGAACTGGATGTG GTGG

GTGGCAGCGTGCAGGGGAATACTTACCAGTTCAGGCTGCTGTATGAACAGACCAAGAATGGGAGCTGTCTTCACCAGAGGTGGGGATCATTCCAGGCCCT

TGACGGCTTTCCCGGATGCACGTTGACCAGCGGCGTGGTGAACTTCTTCTTGGCTCACACGGAACAACTCCGAAGAGTTGGTTTTGATCCCATCTTGCAA

CGAGTGGCCCACGGAG AGTTCTTTATTGATGGGCTGGGGAGACTGTTGGTGGGCTCTTGCCCGGGTGTAATTATAAACCACCAAGTAAGAACACCACCA

AAGGATCCAAAGCTGGCTGCCTTGGAGAAGACTTATGACAAATACCGGGCCAACACCAATTCTGTGATCCAATTCAAGGTTGCACTCCAGTACTTCAAGA

ACCATCTCTACTGCTCCACTTAAAAAGTACCAAGACCAGGAATCGCAATAAACAGATTAGCGGCGGGCAACAAAAAAAATAGTAGGATTGGACATTGGAG

GGTACCAAAAGCAGACTCCTAACAAGGGGAACAGGGAACAAAGAAGCTGGAAGCTGGAGCTAGGGTAGGACCCTGAAGTCGGCTCAGGACCCCCAAGACC

AAATTCTCAGCACAGAGATTTATCTGCCCTAGAGAGAGAAAGGGCAGGGAATGAGACAAAGACAAGGGCTGGAAGGTGGTGGGGCACACCTTTAATCACA

GCACTCCGGGGGCAGAAGCAGGTGGATCTCTGCGCATTTTGAGGACAGCCTGGTCTACAGAGAGAGTTCCAGGACAGCCAGGGCTACAGAGAAACTCTTA

TCTTAAAAAGGCAATAAGTTGATCTAAAATAATGTTATTTAAAGCCAGATGATAAGGTTGGTGTAGTGTTGTGATCCCAAAGCCCAGTAACTGAAGTAGG

AGGATTGAGTTCAAGGCCAGCCTGGGCTATGTAACAGCCCATCTTTAAATGAGTGACTAGGGGGCTGGAGAGAGCTCAGTGCTTAAGAGCGATTAGGACA

GAGGACCTAGATTGGCTCCCAGGACCCACATGATGAGTCACAACTTCATACCTGCAGTTTCAGGGAATTGGAAGCATCTGCTTACCTCCAAAGGCTCCTG

CATATGAGTGGTGCATACATACACGCAGGCACACACATATGCACACAAAATACGCTTTAAAATAAATGAAGGAATGAGTGAATGGCTAAATATTAACCAA

ATAATTCCGATTTTATTTTGTCAAGACTGCCTGGCCTAGCACTCACTGTGTAAGACTGACCTCACACTCATGGCAATCCTCCTGTCTCCACTTCCCAGTG

CTGAGGTATGAGGTGTGAACCACAATTTCTGGCTTGGATTTTTAAAAAGAATTTACACACACACACATACATACACACACACTGTAGCTGTCTTCAGACA

CATCAGAAAGGGCATCAGATCCCATTACAGATGGTTGTGAGCCACCATGTGGTTGCTGGGAATTGAACTCAGAACCTCTGGAAAAGCAGTCAGTGCTCTT

AACTGATAAGCCATCTCTCTAGTCTCTAGCTTGATTTTTAAACTTTGACTTTTAAATATACTTATTCATTATAATTTTTTTTCTTTTTGAGACAGGGTTT

CTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCAGGCTGGCCTCGAACTCAGAAATCCGCCTGCCTCTGCCTCCCGAGGGCTGGGATTAAA

GGCATGCACCACCATGCCCGGCTTATATTTTGATTTTAATGGGATATTAAGATGGATGTTAAGATTGTGAGCTTTCAACCCTGTCTCGGAAAACCAAAAA

AAAAAAAAAAAAGAAAGAAAAGATTGTGAGCCTTCATGTGGTTGTTGGGGATAGAATCTCCACTCACTCCAGTCAACCCTGTTCTCAGTCCCTGCTAACT

CCGGCCCAAAGATTTATTTATTATTATAATTATTATACGTAAGTACACTGTAGCTGACTTCAGACACACTAGAAGAGTGTCAGATCTCATTACCGGTAGT

TGAGTCACCATGTAGTTGCGGGGACTTGAACTCAGGATCTTTGGAAGAGCAGTCCATCCTCTTACCCTCTGAGCCATCTCGCCAGCCCATTTCAACACTC

TGAACATACTTACACTTTATTTTTTACTTCCTGAGGTAAATATTGCTCTGAGCTAGACCATAGAAAGCCAAACACCAGTGGGTAAGGAGGCGAGGAATGA

CATGCCAGCTAGTTGTGGTGTGGGCCTTTAATCCCAGCCTTGAATTCAGAGATCCTCTAGCCAGGGCTAGGCAGTGAGCTCTGTTTTGTTTTGTTTTGTT

CTGTTTTCAGAACAAAACCAAAATCAGGGGCTGAGGAAATGGCTCAAAAGGTGAAGTGTTTGTTACCCAAGCATGAGGACTTGAGTTCAGATTCCCAGAA

GTAAGGCATAGCTGCCAGTCTGTAACCCTGGGCATTCTCACAGCAAATGTTAACATCCTCCATTTTGACTGGGTTGTCGTTAGCATGCTCAAACACAGTC

TTTTCTCTACTTCAAGATCTAGAACCATCTCTCCAGAAGAGAGAGAGAGAGACAGAGAGTGAGTTAGTTTCCTATGATCCAGTAACACCTCTTCCCCAGG

AACACAGGATGTTCTAAAAGGACATCCATTCAACTCAAAGGGTTCAGGGACTCCCTGAAACCCACCAGACAGACTAGGCCCCCTCTTTTCCAAGTATATT

AGCTGTGAAGACTGCTGAGAGGCACTCTCAGACAAGTTGAGCTGCCTGAAACAGACATTCTCTAACCTGTTGAGCTGTCTGCAAGTTGTACAGAGGGCTT

CAAGTTTACAGCTTTTGTGACATGGTGAGCTTTCATGGTGCCGCTGTCTTTCGAGTCATTTGTGATCCTGCGGTAACCCCTCACCCATACTTCTGTCTGT

AACCCCAATAAAACTCATCAGTCTGCTATACTGGA
Translation
MTSS - UNI31544 - SVSFASFRFPWLLKTFVLMVGLATVAFMVRKVSLTTDFSTFKPKFPEPARVDPVLKLLPEEHLRKLFTYSDIW - UNI253

90 - WLFPKNQCDCNSGKLRMKYKFQDAYNQKDLPAVNARRQAEFEHFQRR REGLPRPPPLLAPPNLPFGYPVHGVEVMPLHTILIPG GLQYEGPDA

PVYE VILKASLGTLNTLADVPDDEVQGRGQRQLTISTRHRKVLNFILQHVTYTSTEYYLHKVDTV - UNI18688 - VSMEYESSVAKFPVTIKQQT

VPKLYDPGPE ERKIRNLVTIATKTFLRPHKLKILLQSIRKYYPDITVIVADDSKEPLEINDDYVEYYTMPFGK GWFAGRNLAISQVTTKYVLWVDDDF

LFSDKTKIEVLVDVLEKTELDV VGGSVQGNTYQFRLLYEQTKNGSCLHQRWGSFQALDGFPGCTLTSGVVNFFLAHTEQLRRVGFDPILQRVAHGE EF

FIDGLGRLLVGSCPGVIINHQVRTPPKDPKLAALEKTYDKYRANTNSVIQFKVALQYFKNHLYCST
Transcript ENSMUST00000103158
Sequence
ATGAATTCAAG - UNI31544 - CGTGTCTTTTGCCAGCTTCAGGTTTCCATGGCTCCTCAAGACATTTGTCCTCATGGTAGGACTTGCCACTGTTGC

GTTTATGGTGAGAAAGGTGTCCCTTACAACAGACTTCAGCACCTTCAAGCCAAAGTTTCCAGAGCCTGCAAGGGTTGACCCAGTGCTGAAGCTTCTACCA

GAGGAGCATCTGAGGAAACTCTTTACCTACAGTGACATCTG - UNI25390 - GCTCTTCCCCAAAAATCAGTGTGACTGTAACTCTGGCAAACTGCG

AATGAAATATAAGTTTCAGGATGCCTATAACCAGAAGGACCTTCCAGCTGTGAATGCCAGAAGACAGGCAGAATTTGAGCACTTTCAGAGGAG AGAAGG

GCTGCCTCGCCCACCACCTCTGCTGGCTCCACCCAATCTCCCCTTCGGATACCCAGTCCATGGTGTGGAGGTGATGCCCCTGCATACAATTCTCATCCCA

G GCCTCCAGTATGAAGGGCCAGATGCTCCAGTCTATGAG GTCATCCTGAAAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTGCCAGATGATGA

GGTTCAGGGCAGAGGCCAGAGGCAGCTGACCATTTCCACCAGACATCGGAAGGTCCTGAATTTCATCCTTCAGCATGTGACGTACACCAGCACAGAGTAC

TATCTCCACAAGGTGGACACAG - UNI18688 - TAAGTATGGAATACGAGTCGTCAGTGGCCAAGTTTCCAGTGACTATCAAACAACAGACTGTACC

CAAGTTGTATGACCCTGGACCTG AGAGGAAGATCAGAAACCTGGTGACCATTGCCACGAAGACTTTTCTCCGTCCCCACAAGCTTAAGATCCTGCTTCA

GAGTATTCGAAAATATTACCCAGACATCACCGTGATTGTAGCTGATGACAGCAAGGAGCCCCTGGAAATTAATGATGACTACGTGGAGTACTACACCATG

CCCTTTGGGAAG GGCTGGTTTGCTGGGAGGAACCTGGCCATCTCACAGGTGACTACTAAATATGTCCTCTGGGTGGACGATGACTTTCTCTTCAGCGAC

AAGACCAAGATTGAGGTACTGGTGGATGTCCTGGAGAAAACCGAACTGGATGTG GTGGGTGGCAGCGTGCAGGGGAATACTTACCAGTTCAGGCTGCTG

TATGAACAGACCAAGAATGGGAGCTGTCTTCACCAGAGGTGGGGATCATTCCAGGCCCTTGACGGCTTTCCCGGATGCACGTTGACCAGCGGCGTGGTGA

ACTTCTTCTTGGCTCACACGGAACAACTCCGAAGAGTTGGTTTTGATCCCATCTTGCAACGAGTGGCCCACGGAG AGTTCTTTATTGATGGGCTGGGGA

GACTGTTGGTGGGCTCTTGCCCGGGTGTAATTATAAACCACCAAGTAAGAACACCACCAAAGGATCCAAAGCTGGCTGCCTTGGAGAAGACTTATGACAA

ATACCGGGCCAACACCAATTCTGTGATCCAATTCAAGGTTGCACTCCAGTACTTCAAGAACCATCTCTACTGCTCCACTTAAAAAGTACCAAGACCAGGA

ATCGCAATAAACAGATTAGCGGCGGGCAACAAAAAAAATAGTAGGATTGGACATTGGAGGGTACCAAAAGCAGACTCCTAACAAGGGGAACAGGGAACAA

AGAAGCTGGAAGCTGGAGCTAGGGTAGGACCCTGAAGTCGGCTCAGGACCCCCAAGACCAAATTCTCAGCACAGAGATTTATCTGCCCTAGAGAGAGAAA

GGGCAGGGAATGAGACAAAGACAAGGGCTGGAAGGTGGTGGGGCACACCTTTAATCACAGCACTCCGGGGGCAGAAGCAGGTGGATCTCTGCGCATTTTG

AGGACAGCCTGGTCTACAGAGAGAGTTCCAGGACAGCCAGGGCTACAGAGAAACTCTTATCTTAAAAAGGCAATAAGTTGATCTAAAATAATGTTATTTA

AAGCCAGATGATAAGGTTGGTGTAGTGTTGTGATCCCAAAGCCCAGTAACTGAAGTAGGAGGATTGAGTTCAAGGCCAGCCTGGGCTATGTAACAGCCCA

TCTTTAAATGAGTGACTAGGGGGCTGGAGAGAGCTCAGTGCTTAAGAGCGATTAGGACAGAGGACCTAGATTGGCTCCCAGGACCCACATGATGAGTCAC

AACTTCATACCTGCAGTTTCAGGGAATTGGAAGCATCTGCTTACCTCCAAAGGCTCCTGCATATGAGTGGTGCATACATACACGCAGGCACACACATATG

CACACAAAATACGCTTTAAAATAAATGAAGGAATGAGTGAATGGCTAAATATTAACCAAATAATTCCGATTTTATTTTGTCAAGACTGCCTGGCCTAGCA

CTCACTGTGTAAGACTGACCTCACACTCATGGCAATCCTCCTGTCTCCACTTCCCAGTGCTGAGGTATGAGGTGTGAACCACAATTTCTGGCTTGGATTT

TTAAAAAGAATTTACACACACACACATACATACACACACACTGTAGCTGTCTTCAGACACATCAGAAAGGGCATCAGATCCCATTACAGATGGTTGTGAG

CCACCATGTGGTTGCTGGGAATTGAACTCAGAACCTCTGGAAAAGCAGTCAGTGCTCTTAACTGATAAGCCATCTCTCTAGTCTCTAGCTTGATTTTTAA

ACTTTGACTTTTAAATATACTTATTCATTATAATTTTTTTTCTTTTTGAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGAC

CAGGCTGGCCTCGAACTCAGAAATCCGCCTGCCTCTGCCTCCCGAGGGCTGGGATTAAAGGCATGCACCACCATGCCCGGCTTATATTTTGATTTTAATG

GGATATTAAGATGGATGTTAAGATTGTGAGCTTTCAACCCTGTCTCGGAAAACCAAAAAAAAAAAAAAAAAGAAAGAAAAGATTGTGAGCCTTCATGTGG

TTGTTGGGGATAGAATCTCCACTCACTCCAGTCAACCCTGTTCTCAGTCCCTGCTAACTCCGGCCCAAAGATTTATTTATTATTATAATTATTATACGTA

AGTACACTGTAGCTGACTTCAGACACACTAGAAGAGTGTCAGATCTCATTACCGGTAGTTGAGTCACCATGTAGTTGCGGGGACTTGAACTCAGGATCTT

TGGAAGAGCAGTCCATCCTCTTACCCTCTGAGCCATCTCGCCAGCCCATTTCAACACTCTGAACATACTTACACTTTATTTTTTACTTCCTGAGGTAAAT

ATTGCTCTGAGCTAGACCATAGAAAGCCAAACACCAGTGGGTAAGGAGGCGAGGAATGACATGCCAGCTAGTTGTGGTGTGGGCCTTTAATCCCAGCCTT

GAATTCAGAGATCCTCTAGCCAGGGCTAGGCAGTGAGCTCTGTTTTGTTTTGTTTTGTTCTGTTTTCAGAACAAAACCAAAATCAGGGGCTGAGGAAATG

GCTCAAAAGGTGAAGTGTTTGTTACCCAAGCATGAGGACTTGAGTTCAGATTCCCAGAAGTAAGGCATAGCTGCCAGTCTGTAACCCTGGGCATTCTCAC

AGCAAATGTTAACATCCTCCATTTTGACTGGGTTGTCGTTAGCATGCTCAAACACAGTCTTTTCTCTACTTCAAGATCTAGAACCATCTCTCCAGAAGAG

AGAGAGAGAGACAGAGAGTGAGTTAGTTTCCTATGATCCAGTAACACCTCTTCCCCAGGAACACAGGATGTTCTAAAAGGACATCCATTCAACTCAAAGG

GTTCAGGGACTCCCTGAAACCCACCAGACAGACTAGGCCCCCTCTTTTCCAAGTATATTAGCTGTGAAGACTGCTGAGAGGCACTCTCAGACAAGTTGAG

CTGCCTGAAACAGACATTCTCTAACCTGTTGAGCTGTCTGCAAGTTGTACAGAGGGCTTCAAGTTTACAGCTTTTGTGACATGGTGAGCTTTCATGGTGC

CGCTGTCTTTCGAGTCATTTGTGATCCTGCGGTAACCCCTCACCCATACTTCTGTCTGTAACCCCAATAAAACTCATCAGTCTGCTATACTGGA
Translation
MNSS - UNI31544 - SVSFASFRFPWLLKTFVLMVGLATVAFMVRKVSLTTDFSTFKPKFPEPARVDPVLKLLPEEHLRKLFTYSDIW - UNI253

90 - WLFPKNQCDCNSGKLRMKYKFQDAYNQKDLPAVNARRQAEFEHFQRR REGLPRPPPLLAPPNLPFGYPVHGVEVMPLHTILIPG GLQYEGPDA

PVYE VILKASLGTLNTLADVPDDEVQGRGQRQLTISTRHRKVLNFILQHVTYTSTEYYLHKVDTV - UNI18688 - VSMEYESSVAKFPVTIKQQT

VPKLYDPGPE ERKIRNLVTIATKTFLRPHKLKILLQSIRKYYPDITVIVADDSKEPLEINDDYVEYYTMPFGK GWFAGRNLAISQVTTKYVLWVDDDF

LFSDKTKIEVLVDVLEKTELDV VGGSVQGNTYQFRLLYEQTKNGSCLHQRWGSFQALDGFPGCTLTSGVVNFFLAHTEQLRRVGFDPILQRVAHGE EF

FIDGLGRLLVGSCPGVIINHQVRTPPKDPKLAALEKTYDKYRANTNSVIQFKVALQYFKNHLYCST

For any suggestions or comments, please send an email to unitrap@crg.es