Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013539 (D16H22S680E)
Chromosomal location
Chr 16: 18300920 - 18344007 (-)
Description
Ser/Thr-rich protein T10 in DGCR region  [Source:UniProtKB/Swiss-Prot;Acc:P54797]
RefSeq_dna
NM_138583 
RefSeq_peptide
NP_613049.1 
MGI
MGI:101825 
Uniprot/SWISSPROT
P54797 
Uniprot/SPTREMBL
Q8BTN3 Q99K56 
Human Ortholog
ENSG00000183597 (C22orf25)
Omim not available
UniTrap UNI21917
Vector Insertion
Chr 16: 18324547 - 18343987
Public Clones D041E07 (ggtc)
Private Clones OST314126 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12225
Vector Insertion
Chr 16: 18324449 - 18324544
Public Clones A049A05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32849
Vector Insertion
Chr 16: 18316738 - 18324544
Public Clones IST14899D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18839
Vector Insertion
Chr 16: 18311077 - 18312731
Public Clones not available
Private Clones OST413218 (lexicon) OST251737 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000013683
Sequence
CAGACCTTGTGACCGTGTGAGCAAAGCCACCCTTGCAACCCATGTGCATCATCTTCTTTAAGTTTGATCCTCGTCCTGTTTCCAAAAATGCATACAG - 

UNI12225 - - UNI32849 - GCTCATCTTGGCAGCCAACAGAGATGAATTCTATAACAGGCCGTCCAAGTTGGCAGACTTCTGGGGGAACAACAGT

GAGATCCTCAGTG - UNI32849 - GGCTCGACATGGAGGAAGGCAAGGCAGGAGGAACATGGCTGGGCATCAGCACACGTGGGAAGCTGGGGGCACT

CACCAACTACCTACAGCCCCGGCAAGAGCCAGACGCCCGTGGTAGAG - UNI18839 - GTGAACTTGTGTCTCACTTTCTGACCAGTGACATGGACA

GCCTGTCCTACCTGAAGAAGGTCTCTACAGAGGGCCACCTGTATAACGGCTTTAACATCATAGCAGCTGACCTGAG CACGTCAAAAGGAGATGTTGTTT

GCTACTATGGAAACCGGGGGGAGCCTGAGCCTATTGTCTTGACACCAG GAACCTATGGGCTAAGCAATGCCCTGCTGGAGACGCCCTGGAAGAAGCTGT

GCTTTGGCAAACAACTCTTCATGGAAGCAGTGGAGCAGAGCGAAGCACTCCCTAAGGACGTCCTTGTCACTCAGCTCCTAGATGTCCTCAACAATGAGGA

GGC ACAGCTGCCAGACCCAGCCATTGAGGACCAGGGCCAGGAGTATGTACAGCCAATTCTGAACAAGTATGCAGCTGTGTGTGTCCGCTGTGCCACCTA

TGGCACCAG AACCAACACCATCATCCTTGTGGATGCAAATGGCCACGTGACCTTCACTGAACGGAGCATGCTGGACAAAGACACCTCTCGCTGGGAGAC

CAACACCTATGAGTTCACACTACAGAGTTAGCCCCTGCCAGGTTCCAAGGATGCTGTTCCTGAAGGGCCAGCGTGGACAGGAACCTTTCACGGCCACTCT

GCAGGTCTGTGGCTCAGCCAGCACCCCTAGGACCAGGTTGTTCTGATTTGTGTCCTCATACTCAGCTCAGGGTCTCTCTTTGTACCAATGGAGAACGACA

GAGTTAAATACTAGGCGTGAGTCAGGCCTGGGTATGCCGTATGTGAACACACAGACCTGTTTGTTGCTCAACCCCACTGCCACTGTGTGCACCTGACTGA

TGAGTAGGATCATGCCTCTCACCTCACACGTTTGGGCAGTGGGTCTCATCCATGGACGGGTAACAAAAGCAGACTCTTTACAGAAACTGGAGATCCTGTA

TTTGTTTGTGTTCATATGTGTTCGGTGGTTCTTCATATACGAGGACCCTGTGTGCATTTTCTCAGTCCTGTAGTGTGGACCCTGGGATCTCTTAGACCCC

TGCTTGCCCAGGATTGTGGGTTCTGAGCAAGACATCTTCAACCAGTCCCGTCCATCTCCCATTGCCCTTGTTATGGTATACACCATAGGAATGTGAACTT

GAATGTGCACAGTTGATAATAAATCTTTGAAGTTGT
Translation
MCIIFFKFDPRPVSKNAYR - UNI12225 - - UNI32849 - RLILAANRDEFYNRPSKLADFWGNNSEILSG - UNI32849 - GLDMEEGKA

GGTWLGISTRGKLGALTNYLQPRQEPDARGRG - UNI18839 - GELVSHFLTSDMDSLSYLKKVSTEGHLYNGFNIIAADLS STSKGDVVCYYGNR

GEPEPIVLTPG GTYGLSNALLETPWKKLCFGKQLFMEAVEQSEALPKDVLVTQLLDVLNNEEA AQLPDPAIEDQGQEYVQPILNKYAAVCVRCATYGT

R RTNTIILVDANGHVTFTERSMLDKDTSRWETNTYEFTLQS
Transcript ENSMUST00000115628
Sequence
AGTCGGCGGCGGCGGAGGCG - UNI12225 - - UNI21917 - - UNI32849 - ACCTTGTGACCGTGTGAGCAAAGCCACCCTTGCAACCCAT

GTGCATCATCTTCTTTAAGTTTGATCCTCGTCCTGTTTCCAAAAATGCATACAG - UNI12225 - - UNI32849 - GCTCATCTTGGCAGCCAAC

AGAGATGAATTCTATAACAGGCCGTCCAAGTTGGCAGACTTCTGGGGGAACAACAGTGAGATCCTCAGTG - UNI32849 - GGCTCGACATGGAGGA

AGGCAAGGCAGGAGGAACATGGCTGGGCATCAGCACACGTGGGAAGCTGGGGGCACTCACCAACTACCTACAGCCCCGGCAAGAGCCAGACGCCCGTGGT

AGAG - UNI18839 - GTGAACTTGTGTCTCACTTTCTGACCAGTGACATGGACAGCCTGTCCTACCTGAAGAAGGTCTCTACAGAGGGCCACCTGTA

TAACGGCTTTAACATCATAGCAGCTGACCTGAG CACGTCAAAAGGAGATGTTGTTTGCTACTATGGAAACCGGGGGGAGCCTGAGCCTATTGTCTTGAC

ACCAG GAACCTATGGGCTAAGCAATGCCCTGCTGGAGACGCCCTGGAAGAAGCTGTGCTTTGGCAAACAACTCTTCATGGAAGCAGTGGAGCAGAGCGA

AGCACTCCCTAAGGACGTCCTTGTCACTCAGCTCCTAGATGTCCTCAACAATGAGGAGGC ACAGCTGCCAGACCCAGCCATTGAGGACCAGGGCCAGGA

GTATGTACAGCCAATTCTGAACAAGTATGCAGCTGTGTGTGTCCGCTGTGCCACCTATGGCACCAG AACCAACACCATCATCCTTGTGGATGCAAATGG

CCACGTGACCTTCACTGAACGGAGCATGCTGGACAAAGACACCTCTCGCTGGGAGACCAACACCTATGAGTTCACACTACAGAGTTAGCCCCTGCCAGGT

TCCAAGGATGCTGTTCCTGAAGGGCCAGCGTGGACAGGAACCTTTCACGGCCACTCTGCAGGTCTGTGGCTCAGCCAGCACCCCTAGGACCAGGTTGTTC

TGATTTGTGTCCTCATACTCAGCTCAGGGTCTCTCTTTGTACCAATGGAGAACGACAGAGTTAAATACTAGGCGTGAGTCAGGCCTGGGTATGCCGTATG

TGAACACACAGACCTGTTTGTTGCTCAACCCCACTGCCACTGTGTGCACCTGACTGATGAGTAGGATCATGCCTCTCACCTCACACGTTTGGGCAGTGGG

TCTCATCCATGGACGGGTAACAAAAGCAGACTCTTTACAGAAACTGGAGATCCTGTATTTGTTTGTGTTCATATGTGTTCGGTGGTTCTTCATATACGAG

GACCCTGTGTGCATTTTCTCAGTCCTGTAGTGTGGACCCTGGGATCTCTTAGACCCCTGCTTGCCCAGGATTGTGGGTTCTGAGCAAGACATCTTCAACC

AGTCCCGTCCATCTCCCATTGCCCTTGTTATGGTATACACCATAGGAATGTGAACTTGAATGTGCACAGTTGATAATAAATCTTTGAAGTTGT
Translation
 - UNI12225 - - UNI21917 - - UNI32849 - MCIIFFKFDPRPVSKNAYR - UNI12225 - - UNI32849 - RLILAANRDEFYNR

PSKLADFWGNNSEILSG - UNI32849 - GLDMEEGKAGGTWLGISTRGKLGALTNYLQPRQEPDARGRG - UNI18839 - GELVSHFLTSDMDS

LSYLKKVSTEGHLYNGFNIIAADLS STSKGDVVCYYGNRGEPEPIVLTPG GTYGLSNALLETPWKKLCFGKQLFMEAVEQSEALPKDVLVTQLLDVLN

NEEA AQLPDPAIEDQGQEYVQPILNKYAAVCVRCATYGTR RTNTIILVDANGHVTFTERSMLDKDTSRWETNTYEFTLQS

For any suggestions or comments, please send an email to unitrap@crg.es