Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013663 (Pten)
Chromosomal location
Chr 19: 32832089 - 32894554 (+)
Description
phosphatase and tensin homolog Gene [Source:MGI (curated);Acc:Pten-001]
RefSeq_dna
NM_008960 
RefSeq_peptide
NP_032986.1 
UniGene
Mm.245395 
MGI
MGI:109583 
Uniprot/SWISSPROT
O08586 
Uniprot/SPTREMBL
Q3UFB0 Q3UUT8 Q8BSR7 
Human Ortholog
ENSG00000171862 (PTEN)
Omim 137800 - GLIOMA OF BRAIN, FAMILIAL  153480 - BANNAYAN-RILEY-RUVALCABA SYNDROME  158350 - COWDEN DISEASE  176807 - PROSTATE CANCER  176920 - PROTEUS SYNDROME  275355 - SQUAMOUS CELL CARCINOMA, HEAD AND NECK  276950 - VACTERL ASSOCIATION WITH HYDROCEPHALUS  605309 - MACROCEPHALY/AUTISM SYNDROME  608089 - ENDOMETRIAL CANCER  612242 - CHROMOSOME 10q23 DELETION SYNDROME  
UniTrap UNI32364
Vector Insertion
Chr 19: 32833014 - 32850504
Public Clones (sanger) PST22435-NR (escells) IST14434E2 (tigm) IST14312C10 (tigm)
IST10539E10 (tigm) IST14572D5 (tigm) IST10879B10 (tigm) IST11001B3 (tigm)
IST11360E10 (tigm) IST10860F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI435
Vector Insertion
Chr 19: 32850590 - 32867038
Public Clones AG0202 (sanger) DD0436 (sanger) AG0201 (sanger) IST10894D2 (tigm)
IST13571D3 (tigm) IST14649D11 (tigm)
Private Clones OST392897 (lexicon) OST389689 (lexicon) OST337983 (lexicon) OST310557 (lexicon)
OST309129 (lexicon) OST173488 (lexicon) OST38599 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11046
Vector Insertion
Chr 19: 32867084 - 32872560
Public Clones F15192 (ggtc) E115D01 (ggtc)
Private Clones OST430661 (lexicon) OST345387 (lexicon) OST283859 (lexicon) OST144018 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18364
Vector Insertion
Chr 19: 32872605 - 32874350
Public Clones not available
Private Clones OST424913 (lexicon) OST235451 (lexicon) OST234255 (lexicon) OST144195 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20342
Vector Insertion
Chr 19: 32874590 - 32886185
Public Clones not available
Private Clones OST366729 (lexicon) OST314464 (lexicon) OST70888 (lexicon) OST67441 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36123
Vector Insertion
Chr 19: 32892551 - 32894332
Public Clones IST11721F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000013807
Sequence
GTCGGGACGCGGCTGCGCTCAGCTCTCTCCTCTCGGAAGCTGCAGCCATGATGGAAGTTTGAGAGTTGAGCCGCTGTGAGGCCAGGCCCGGCGCAGGCGA

GGGAGATGAGAGACGGCGGCGGCCACGGCCCAGAGCCCCTCTCAGCGCCTGTGAGCAGCCGCGGGGGCAGCGCCCTCGGGGAGCCGGCCGGGCGGCGGCG

GCGGCAGCGGCGGCGGGCCTCGCCTCCTCGTCGTCTGTTCTAACCGGGCAGCTTCTGAGCAGCTTCGGAGAGAGACGGTGGAAGAAGCCGTGGGCTCGAG

CGGGAGCCGGCGCAGGCTCGGCGGCTGCACCTCCCGCTCCTGGAGCGGGGGGGAGAAGCGGCGGCGGCGGCCGCGGCTCCGGGGAGGGGGTCGGAGTCGC

CTGTCACCATTGCCAGGGCTGGGAACGCCGGAGAGTTGCTCTCTCCCCTTCTCCTGCCTCCAACACGGCGGCGGCGGCGGCGGCACGTCCAGGGACCCGG

GCCGGTGTTAAGCCTCCCGTCCGCCGCCGCCGCACCCCCCCTGGCCCGGGCTCCGGAGGCCGCCGGAGGAGGCAGCCGCTGCGAGGATTATCCGTCTTCT

CCCCATTCCGCTGCCTCGGCTGCCAGGCCTCTGGCTGCTGAGGAGAAGCAGGCCCAGTCTCTGCAACCATCCAGCAGCCGCCGCAGCAGCCATTACCCGG

CTGCGGTCCAGGGCCAAGCGGCAGCAGAGCGAGGGGCATCAGCGACCGCCAAGTCCAGAGCCATTTCCATCCTGCAGAAGAAGCCTCGCCACCAGCAGCT

TCTGCCATCTCTCTCCTCCTTTTTCTTCAGCCACAGGCTCCCAGACATGACAGCCATCATCAAAGAGATCGTTAGCAGAAACAAAAGGAGATATCAAGAG

GATGGATTCGACTTAGACTTGACCT - UNI32364 - ATATTTATCCAAATATTATTGCTATGGGATTTCCTGCAGAAAGACTTGAAGGTGTATACAG

GAACAATATTGATGATGTAGTAAG - UNI435 - GTTTTTGGATTCAAAGCATAAAAACCATTACAAGATATACAATCT - UNI11046 - ATGTG

CTGAGAGACATTATGACACCGCCAAATTTAACTGCAGAG - UNI18364 - TTGCACAGTATCCTTTTGAAGACCATAACCCACCACAGCTAGAACTT

ATCAAACCCTTCTGTGAAGATCTTGACCAATGGCTAAGTGAAGATGACAATCATGTTGCAGCAATTCACTGTAAAGCTGGAAAGGGACGGACTGGTGTAA

TGATTTGTGCATATTTATTGCATCGGGGCAAATTTTTAAAGGCACAAGAGGCCCTAGATTTTTATGGGGAAGTAAGGACCAGAGACAAAAAG - UNI20

342 - GGAGTCACAATTCCCAGTCAGAGGCGCTATGTATATTATTATAGCTACCTGCTAAAAAATCACCTGGATTACAGACCCGTGGCACTGCTGTTTC

ACAAGATGATGTTTGAAACTATTCCAATGTTCAGTGGCGGAACTTGCA ATCCTCAGTTTGTGGTCTGCCAGCTAAAGGTGAAGATATATTCCTCCAATT

CAGGACCCACGCGGCGGGAGGACAAGTTCATGTACTTTGAGTTCCCTCAGCCATTGCCTGTGTGTGGTGATATCAAAGTAGAGTTCTTCCACAAACAGAA

CAAGATGCTCAAAAAG GACAAAATGTTTCACTTTTGGGTAAATACGTTCTTCATACCAGGACCAGAGGAAACCTCAGAAAAAGTGGAAAATGGAAGTCT

TTGTGATCAGGAAATCGATAGCATTTGCAGTATAGAGCGTGCAGATAATGACAAGGAGTATCTTGTACTCACCCTAACAAAAAACGATCTTGACAAAGCA

AACAAAGACAAGGCCAACCGATACTTCTCTCCAAATTTTAAG GTGAAACTATACTTTACAAAAACAGTAGAGGAGCCATCAAATCCAGAGGCTAGCAGT

TCAACTTCTGTGACTCCAGATGTTAGTGACAATGAACCTGATCATTATAGATATTCTGACACCACTGACTCTGATCCAGAGAATGAACCTTTTGATGAAG

ATCAGCATTCACAAATTACAAAAGTCTGATTTTTTTTTTCTTATCAAGAGGGATAAAATACCATG
Translation
MTAIIKEIVSRNKRRYQEDGFDLDLTY - UNI32364 - YIYPNIIAMGFPAERLEGVYRNNIDDVVR - UNI435 - RFLDSKHKNHYKIYNL -

 UNI11046 - LCAERHYDTAKFNCRV - UNI18364 - VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHR

GKFLKAQEALDFYGEVRTRDKK - UNI20342 - GVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCN NPQFVVCQLKVKIYS

SNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKK DKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDL

DKANKDKANRYFSPNFK VKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV

For any suggestions or comments, please send an email to unitrap@crg.es