Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013736 (Trnt1)
Chromosomal location
Chr 6: 106719114 - 106732458 (+)
Description
tRNA nucleotidyl transferase, CCA-adding, 1 Gene [Source:MGI (curated);Acc:Trnt1-001]
RefSeq_dna
NM_027296 
RefSeq_peptide
NP_081572.1 
UniGene
Mm.196332 Mm.448475 
MGI
MGI:1917297 
Uniprot/SWISSPROT
Q8K1J6 
Human Ortholog
ENSG00000072756 (TRNT1)
Omim not available
UniTrap UNI27531
Vector Insertion
Chr 6: 106719251 - 106719823
Public Clones 5SE223E07 (ggtc)
Private Clones OST57443 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14408
Vector Insertion
Chr 6: 106719998 - 106723278
Public Clones FHCRC-GT-S14-7A1 (fhcrc)
Private Clones OST260388 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI498
Vector Insertion
Chr 6: 106723473 - 106724399
Public Clones CH0841 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113247
Sequence
GCGGCTCTTCGTGCGTGCTGACGTCACTGGTCCGCGACCCGGAAGTGCGCGTGCGGCCCGGGCAGCAGGCGG - UNI27531 - ATGTGTGATTGGCG

ACTTGTCTCCAGATGCAGAGCGTCCTGTATCCTTGGCACAGGCAGGTCCTGAGGTGTAGTTGGAGTAGATTGTGCCTTCTGAAGCGATACCTGTTTACAA

TGAAGTTGCAGTCCCCAGAATTCCAGTCCCTTTTCACCGAAGGATTGAAGAGCCTGACAG - UNI14408 - AATTATTTGCCAAAGAGAATCATGAA

TTAAGAATAGCAGGAGGAGCAGTGAGGGATTTACTGAATGGGGTGAAGCCTCAAGATGTGGATTTCGCCACCACTGCCACCCCTACTCAGATGAAGGAGA

TGTTCCAGTCAGCTGGCATTCGCATGATCAACAACAAAGGAGAGAAACATGGGACTATCACTGCCAGG - UNI498 - CTTCATGAAGAAAATTTTGA

AGTTACTACACTCCGAATTGATGTTACCACTGATGGAAGACATGCAGAGGTAGAATTCACAACTGACTGGCAGAAAGACGCTGAACGAAGAGATCTCACT

ATAAATTCTATGTTTCTAG GTTTTGATGGTACACTGTTTGATTACTTCAATGGTTATGCAGATTTAAAAAATAAAAAGGTTCGATTTGTTGGACATGCA

AAACAGAGAATTCAGGAAGATTATCTTCGAATTTTAAGGTATTTCAG GCCAGGTATTGTGCTCGGTGATCTTACTACAGAGAAATGACTTAAGCTGTGC

TCTACCTCAAGGACCTAGAGTCGATGTTCTGGAACATATTCGGTGCCTCACCAAAAAATGACACAGAAAGAGAGTGCTAGCAAGTGGTACAACAAATCAG

AGTATTCCGATACTTAAAAGTTGGAGAAACTGGCTAAGTGTGAAATGCAGTGATAGTTGTGTGGGTATTAGTGGTTTTAATTTTTGTAGATTTTTAACTG

ATGCATAAACACTAGTTATACATGTATATATAATGTCTTGATACATTGGTATTGAAGGTAAACACATCTCTTCCCTCAAAGCTATCATGTTTAGGCTAAA

AGCATTCAATCCCCTTGTGAACTTTTTGGTTATCTGTAGTCCCTCTACTTTGCAGCAGTGATGAGAATGTCATCTGTGTCCTTGTACCTTAGTCCTCATG

GATAAGTCAACTAACATATCCTAGTCCTCAGCTTACCCTAGTTTGGTTACATGTGTATTATGCATTACTTGGCTTTTTGTGTCCAGATTATTTAACTCTT

ATCTCTAACTTTATTATTATAAATGACAAGATATGGTGGTGGATATGCCTATAATCCTAACACTGAGGGATCCTAAGGCATGAAGGCCATGAGTTCAATG

CCAGCCTTGGCTACACAGTGAGTTTGAGGTCACTGTACCACATTTTTGGTGTGCTCCATTTTTTGTCAGTGGATCATCAGTTCACTTTCATTTCTTGGCT

GTTTGTTTTCAAAAGTGAACCACAGTGAACACAGGAGAGCCAGGATCACATCCTGACACAGACCTGACTGCCTTTGGATAGATAAACTCGAGGGTGCATC

TCTTTTCTGTCTTCAGAGGAGCCGCCCCAGCTTTCACAGGGCCTGTACTAGTTTATTTCAGGTTAGCTTTGCAAGTAGGTTTCTGTATGACTTCTGTCTC

ACTTGTGCTATTCTTACTGGAATAATATCCTGTAATTTCATGTGCATTTGAGTTTCTTCTATAATCTAATGCCTCATCAGATGTGCCATTCATTTTGTAG

GTTGTATCTTGATAATTTCTTACCAGTAAATTTTTTTTTTTAAATCCAAATTTTAACCTTTAAGGAAAAAAATCAAAAACCCTCTACCTAGCTAGGGTAC

ATCTAGTAACATTGTTCACTGATGAGATCAGAGTACTGTGTAGCATAGCATATTTTATCAATAAATCGAAGTTTTC
Translation
 - UNI27531 - MQSVLYPWHRQVLRCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTE - UNI14408 - ELFAKENHELRIAGGAVRDLLN

GVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITAR - UNI498 - LHEENFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF

LG GFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFR RPGIVLGDLTTEK
Transcript ENSMUST00000101098
Sequence
AAGCGGGTCTTCGGAGTAGGAGCGCCACGTTTCTAAGACACCTTGGCGACCTGGCTGTGCAGC - UNI27531 - ATGTGTGATTGGCGACTTGTCTC

CAGATGCAGAGCGTCCTGTATCCTTGGCACAGGCAGGTCCTGAGGTGTAGTTGGAGTAGATTGTGCCTTCTGAAGCGATACCTGTTTACAATGAAGTTGC

AGTCCCCAGAATTCCAGTCCCTTTTCACCGAAGGATTGAAGAGCCTGACAG - UNI14408 - AATTATTTGCCAAAGAGAATCATGAATTAAGAATA

GCAGGAGGAGCAGTGAGGGATTTACTGAATGGGGTGAAGCCTCAAGATGTGGATTTCGCCACCACTGCCACCCCTACTCAGATGAAGGAGATGTTCCAGT

CAGCTGGCATTCGCATGATCAACAACAAAGGAGAGAAACATGGGACTATCACTGCCAGG - UNI498 - CTTCATGAAGAAAATTTTGAAGTTACTAC

ACTCCGAATTGATGTTACCACTGATGGAAGACATGCAGAGGTAGAATTCACAACTGACTGGCAGAAAGACGCTGAACGAAGAGATCTCACTATAAATTCT

ATGTTTCTAG GTTTTGATGGTACACTGTTTGATTACTTCAATGGTTATGCAGATTTAAAAAATAAAAAGGTTCGATTTGTTGGACATGCAAAACAGAGA

ATTCAGGAAGATTATCTTCGAATTTTAAGGTATTTCAG GCCAGGTATTGTGCTCGGTGATCTTACTACAGAGAAATGA
Translation
 - UNI27531 - MQSVLYPWHRQVLRCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTE - UNI14408 - ELFAKENHELRIAGGAVRDLLN

GVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITAR - UNI498 - LHEENFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF

LG GFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFR RPGIVLGDLTTEK
Transcript ENSMUST00000113248
Sequence
GCGCGTGCGGCCCGGGCAGCAGGCGG - UNI27531 - ATGTGTGATTGGCGACTTGTCTCCAGATGCAGAGCGTCCTGTATCCTTGGCACAGGCAGG

TCCTGAGGTGTAGTTGGAGTAGATTGTGCCTTCTGAAGCGATACCTGTTTACAATGAAGTTGCAGTCCCCAGAATTCCAGTCCCTTTTCACCGAAGGATT

GAAGAGCCTGACAG - UNI14408 - AATTATTTGCCAAAGAGAATCATGAATTAAGAATAGCAGGAGGAGCAGTGAGGGATTTACTGAATGGGGTGA

AGCCTCAAGATGTGGATTTCGCCACCACTGCCACCCCTACTCAGATGAAGGAGATGTTCCAGTCAGCTGGCATTCGCATGATCAACAACAAAGGAGAGAA

ACATGGGACTATCACTGCCAGG - UNI498 - CTTCATGAAGAAAATTTTGAAGTTACTACACTCCGAATTGATGTTACCACTGATGGAAGACATGCA

GAGGTAGAATTCACAACTGACTGGCAGAAAGACGCTGAACGAAGAGATCTCACTATAAATTCTATGTTTCTAG GTTTTGATGGTACACTGTTTGATTAC

TTCAATGGTTATGCAGATTTAAAAAATAAAAAGGTTCGATTTGTTGGACATGCAAAACAGAGAATTCAGGAAGATTATCTTCGAATTTTAAGGTATTTCA

G GTTTTATGGCAGAATTGTCGACAGACCTGGTGACCATGACCATGAGACTCTAGAAGCAATTGCAGAAAATGCCAAAGGTTTGGCTGGAATATCAGGAG

AGAGGATTTGGGTAGAACTGAAGAAAATTCTTACTGGTGACCATGTAAACCATTTGATCCACCTGATCTATGATCTTGGTGTGGCTCCTCACATAG GTT

TACCTGCTAATGCAAATTTAGAAGAATTTAACAAAGTCAGTAAAAATGTTGAAGGCTTTTCACCAAAACCAATGACTCTTTTGGCTTCTTTATTCAAAGT

ACAAGATGATGTCACAAAATTGGACTTGAGATTGAAAATTTCAAAAGAGGAGAAAAACCTGGGTTTATTTATAGTTAAAAACAGGAAAGACTTGATTAAA

GCAACAGATAGTTCAGAACCATTGAAACCATACCAAGACTTTGTGATAGAC TCTAGGGAACCAGATGCAACTGCCCGTGTTTGTGAGCTGCTGAAGTAC

CAAGGAGAGCATGGTCTTCTCAAAGAGATGCAGCAGTGGTCTGTCCCGCCGTTCCCTGTGAGTGGACATGACATCAGGAAAGTGGGTATTTCTTCAGGGA

AGGAAATTGGGGCCCTGCTACAGCAGTTGCGTGAACAGTGGAAGAAAAGTGGTTACCGGATGGAAAAAGATGAACTACTAAGTTACATAAAGAAGACCTA

AAGATGAGCCCTGTATGAAACAGGGGAAGTCTTG AAAGTTCA
Translation
 - UNI27531 - MQSVLYPWHRQVLRCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTE - UNI14408 - ELFAKENHELRIAGGAVRDLLN

GVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITAR - UNI498 - LHEENFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF

LG GFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFR RFYGRIVDRPGDHDHETLEAIAENAKGLAGISGERIWVELKKILTGDHVNHLI

HLIYDLGVAPHIG GLPANANLEEFNKVSKNVEGFSPKPMTLLASLFKVQDDVTKLDLRLKISKEEKNLGLFIVKNRKDLIKATDSSEPLKPYQDFVID 

SREPDATARVCELLKYQGEHGLLKEMQQWSVPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYRMEKDELLSYIKKT 
Transcript ENSMUST00000113249
Sequence
CGTCACTGGTCCGCGACCCGGAAGTGCGCGTGCGGCCCGGGCAGCAGGCGG - UNI27531 - ATGCAGAGCGTCCTGTATCCTTGGCACAGGCAGGT

CCTGAGGTGTAGTTGGAGTAGATTGTGCCTTCTGAAGCGATACCTGTTTACAATGAAGTTGCAGTCCCCAGAATTCCAGTCCCTTTTCACCGAAGGATTG

AAGAGCCTGACAG - UNI14408 - AATTATTTGCCAAAGAGAATCATGAATTAAGAATAGCAGGAGGAGCAGTGAGGGATTTACTGAATGGGGTGAA

GCCTCAAGATGTGGATTTCGCCACCACTGCCACCCCTACTCAGATGAAGGAGATGTTCCAGTCAGCTGGCATTCGCATGATCAACAACAAAGGAGAGAAA

CATGGGACTATCACTGCCAGG - UNI498 - CTTCATGAAGAAAATTTTGAAGTTACTACACTCCGAATTGATGTTACCACTGATGGAAGACATGCAG

AGGTAGAATTCACAACTGACTGGCAGAAAGACGCTGAACGAAGAGATCTCACTATAAATTCTATGTTTCTAG GTTTTGATGGTACACTGTTTGATTACT

TCAATGGTTATGCAGATTTAAAAAATAAAAAGGTTCGATTTGTTGGACATGCAAAACAGAGAATTCAGGAAGATTATCTTCGAATTTTAAGGTATTTCAG

 GTTTTATGGCAGAATTGTCGACAGACCTGGTGACCATGACCATGAGACTCTAGAAGCAATTGCAGAAAATGCCAAAGGTTTGGCTGGAATATCAGGAGA

GAGGATTTGGGTAGAACTGAAGAAAATTCTTACTGGTGACCATGTAAACCATTTGATCCACCTGATCTATGATCTTGGTGTGGCTCCTCACATAG GTTT

ACCTGCTAATGCAAATTTAGAAGAATTTAACAAAGTCAGTAAAAATGTTGAAGGCTTTTCACCAAAACCAATGACTCTTTTGGCTTCTTTATTCAAAGTA

CAAGATGATGTCACAAAATTGGACTTGAGATTGAAAATTTCAAAAGAGGAGAAAAACCTGGGTTTATTTATAGTTAAAAACAGGAAAGACTTGATTAAAG

CAACAGATAGTTCAGAACCATTGAAACCATACCAAGACTTTGTGATAGAC TCTAGGGAACCAGATGCAACTGCCCGTGTTTGTGAGCTGCTGAAGTACC

AAGGAGAGCATGGTCTTCTCAAAGAGATGCAGCAGTGGTCTGTCCCGCCGTTCCCTGTGAGTGGACATGACATCAGGAAAGTGGGTATTTCTTCAGGGAA

GGAAATTGGGGCCCTGCTACAGCAGTTGCGTGAACAGTGGAAGAAAAGTGGTTACCGGATGGAAAAAGATGAACTACTAAGTTACATAAAGAAGACCTAA

AGATGAGCCCTGTATGAAACAGGGGAAGTCTTG AAAGTTCATCTAAAACTAAATGAAGAGTCAACAAGAAAAGTAAACAGCTGTATTACCCGGGAAACC

AGCTGTGCACTGTAGAAGGCCGGCCTATCAGATTCAGGTTGGACGCTTTATACACAGTCAGTGTCTCATGTACATATCCATGAGGATTCACATATGCTGC

CATTGGACCACATAAGGATAAACTACAGACAAAGAAATAATGTGGAGAATAAGACAATG
Translation
 - UNI27531 - MQSVLYPWHRQVLRCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTE - UNI14408 - ELFAKENHELRIAGGAVRDLLN

GVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITAR - UNI498 - LHEENFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF

LG GFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFR RFYGRIVDRPGDHDHETLEAIAENAKGLAGISGERIWVELKKILTGDHVNHLI

HLIYDLGVAPHIG GLPANANLEEFNKVSKNVEGFSPKPMTLLASLFKVQDDVTKLDLRLKISKEEKNLGLFIVKNRKDLIKATDSSEPLKPYQDFVID 

SREPDATARVCELLKYQGEHGLLKEMQQWSVPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYRMEKDELLSYIKKT 
Transcript ENSMUST00000057578
Sequence
AAGCGGGTCTTCGGAGTAGGAGCGCCACGTTTCTAAGACACCTTGGCGACCTGGCTGTGCAGC - UNI27531 - ATGTGTGATTGGCGACTTGTCTC

CAGATGCAGAGCGTCCTGTATCCTTGGCACAGGCAGGTCCTGAGGTGTAGTTGGAGTAGATTGTGCCTTCTGAAGCGATACCTGTTTACAATGAAGTTGC

AGTCCCCAGAATTCCAGTCCCTTTTCACCGAAGGATTGAAGAGCCTGACAG - UNI14408 - AATTATTTGCCAAAGAGAATCATGAATTAAGAATA

GCAGGAGGAGCAGTGAGGGATTTACTGAATGGGGTGAAGCCTCAAGATGTGGATTTCGCCACCACTGCCACCCCTACTCAGATGAAGGAGATGTTCCAGT

CAGCTGGCATTCGCATGATCAACAACAAAGGAGAGAAACATGGGACTATCACTGCCAGG - UNI498 - CTTCATGAAGAAAATTTTGAAGTTACTAC

ACTCCGAATTGATGTTACCACTGATGGAAGACATGCAGAGGTAGAATTCACAACTGACTGGCAGAAAGACGCTGAACGAAGAGATCTCACTATAAATTCT

ATGTTTCTAG GTTTTGATGGTACACTGTTTGATTACTTCAATGGTTATGCAGATTTAAAAAATAAAAAGGTTCGATTTGTTGGACATGCAAAACAGAGA

ATTCAGGAAGATTATCTTCGAATTTTAAGGTATTTCAG GTTTTATGGCAGAATTGTCGACAGACCTGGTGACCATGACCATGAGACTCTAGAAGCAATT

GCAGAAAATGCCAAAGGTTTGGCTGGAATATCAGGAGAGAGGATTTGGGTAGAACTGAAGAAAATTCTTACTGGTGACCATGTAAACCATTTGATCCACC

TGATCTATGATCTTGGTGTGGCTCCTCACATAG GTTTACCTGCTAATGCAAATTTAGAAGAATTTAACAAAGTCAGTAAAAATGTTGAAGGCTTTTCAC

CAAAACCAATGACTCTTTTGGCTTCTTTATTCAAAGTACAAGATGATGTCACAAAATTGGACTTGAGATTGAAAATTTCAAAAGAGGAGAAAAACCTGGG

TTTATTTATAGTTAAAAACAGGAAAGACTTGATTAAAGCAACAGATAGTTCAGAACCATTGAAACCATACCAAGACTTTGTGATAGAC TCTAGGGAACC

AGATGCAACTGCCCGTGTTTGTGAGCTGCTGAAGTACCAAGGAGAGCATGGTCTTCTCAAAGAGATGCAGCAGTGGTCTGTCCCGCCGTTCCCTGTGAGT

GGACATGACATCAGGAAAGTGGGTATTTCTTCAGGGAAGGAAATTGGGGCCCTGCTACAGCAGTTGCGTGAACAGTGGAAGAAAAGTGGTTACCGGATGG

AAAAAGATGAACTACTAAGTTACATAAAGAAGACCTAAAGATGAGCCCTGTATGAAACAGGGGAAGTCTTG AAAGTTCATCTAAAACTAAATGAAGAGT

CAACAAGAAAAGTAAACAGCTGTATTACCCGGGAAACCAGCTGTGCACTGTAGAAGGCCGGCCTATCAGATTCAGGTTGGACGCTTTATACACAGTCAGT

GTCTCATGTACATATCCATGAGGATTCACATATGCTGCCATTGGACCACATAAGGATAAACTACAGACAAAGAAATAATGTGGAGAATAAGACAATGAAA

AGAAAAATAGTAATCCCAGTTTTTTACTTATTTGGGACATAAGTTATGCTTTTTAACCTTTGAATTTTAGATATTATATAGTACTTTGTGTAAAATGTAA

GACAAGTATACAGGAGGTTGGCAGATATTCTGTTGCTTAAAAATGTTCTTTGATGATTCAAAGGTAAATATATGTGTTTACAAAGCCTAGTGAGGTCATG

TTTTCATCTTTGGACATTTAGTTACTTTACCTACATATCAGTTTCCTGACCTTCTTGATCTGTAGTTCTAATGAATTCATCAAAGTGTTAAGCTTCACAG

CATCAGCACATGTTCAGAGACCCACCCAATTTTGGTCCCGTGTAGCAGAACTAGCTGAAGTATAATGCTTGAAGCATTCCTATTATGCTTTAAGATAGGA

TGTGTCTAAACAAAAATTGAGGGGAAAAAGACTGTATTACAGATGTTTCCAGGCTGTAAGACAGCTTGCCCTGTGTTTATCTCCTTTACTGAGATAAACG

CATATTTTTTAGGCACTGGAGAAAATATGGAAAGTGGAACCACAGAAGGGAATATGGAAATATATTAAAAATGTAATAAAGATCTTACCT
Translation
 - UNI27531 - MQSVLYPWHRQVLRCSWSRLCLLKRYLFTMKLQSPEFQSLFTEGLKSLTE - UNI14408 - ELFAKENHELRIAGGAVRDLLN

GVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITAR - UNI498 - LHEENFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF

LG GFDGTLFDYFNGYADLKNKKVRFVGHAKQRIQEDYLRILRYFR RFYGRIVDRPGDHDHETLEAIAENAKGLAGISGERIWVELKKILTGDHVNHLI

HLIYDLGVAPHIG GLPANANLEEFNKVSKNVEGFSPKPMTLLASLFKVQDDVTKLDLRLKISKEEKNLGLFIVKNRKDLIKATDSSEPLKPYQDFVID 

SREPDATARVCELLKYQGEHGLLKEMQQWSVPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYRMEKDELLSYIKKT 

For any suggestions or comments, please send an email to unitrap@crg.es