Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013787 (Ehmt2)
Chromosomal location
Chr 17: 35035444 - 35050990 (+)
Description
euchromatic histone lysine N-methyltransferase 2 Gene [Source:MGI (curated);Acc:Ehmt2-003]
RefSeq_dna
NM_145830 NM_147151 
RefSeq_peptide
NP_665829.1 NP_671493.1 
UniGene
Mm.35345 
MGI
MGI:2148922 
Uniprot/SWISSPROT
Q9Z148 
Uniprot/SPTREMBL
A2CG76 Q3U4G9 Q8BP38 A2CG75 A2CG77 A2CG73 A2CG74 
Human Ortholog
ENSG00000204371 (EHMT2)
Omim not available
UniTrap UNI29415
Vector Insertion
Chr 17: 35036862 - 35039958
Public Clones CMHD-GT_428E1-3 (cmhd) PST24448-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15135
Vector Insertion
Chr 17: 35042657 - 35042854
Public Clones PST10801-NL (escells) PST10232-NR (escells) PST12338-NR (escells) PST9425-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15688
Vector Insertion
Chr 17: 35043004 - 35043095
Public Clones PST4333-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1735
Vector Insertion
Chr 17: 35044590 - 35044687
Public Clones CG0315 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34565
Vector Insertion
Chr 17: 35047781 - 35047922
Public Clones IST13598F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16017
Vector Insertion
Chr 17: 35048611 - 35049333
Public Clones not available
Private Clones OST467883 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12889
Vector Insertion
Chr 17: 35049755 - 35050584
Public Clones CMHD-GT_338F2-3 (cmhd)
Private Clones OST19681 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097342
Sequence
ATGCGGGGTCTGCCGAGAGGGAGGGGGCTGATGCGGGCCCGGGGGCGGGGGCGTGCGGCCCCCACGGGCGGCCGCGGCCGCGGTCGGGGGGGCGCCCACC

GAGGGCGAGGTAGGCCCCGAAGCCTGCTCTCGCTGCCCAGGGCCCAGGCGTCTTGGGCCCCCCAGCTGCCTGCCGGGCTGACCGGCCCCCCGGTTCCTTG

TCTCCCCTCCCAGGGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAGCCCCGAGGAGCCGCCGAGAGAG TTCATAGCTCTTTGGGGGA

CACCCCTCAGAGTGAGGAGACCCTTCCCAAGGCCAACCCCGACTCCTTGGAGCCTGCCGGCCCCTCCTCTCCGGCCTCTGTCACTGTCACCGTCGGCGAT

GAGGGGGCTGACACCCCTGTCGGGGCCGCATCACTCATCGGGGACGAACCCGAGAGCCTGGAGGGAGATGGGGGTCGCATCGTGCTGG GCCATGCCACA

AAGTCGTTCCCCTCTTCCCCCAGCAAGGGGGGTGCCTGTCCCAGTCGGGCCAAAATGTCAATGACAGGGGCAGGAAAGTCGCCCCCCTCGGTCCAGAGTT

TGGCCATGAGGCTGTTGAGCATGCCCGGGGCCCAGGGAGCTGCAACTGCTGGGCCTGAACCCTCTCCGGCAACAACTGCCGCCCAGGAGGGGCAGCCCAA

AGTGCACCGAGCCCGGAAAACCATGTCCAAACCTAGCAACGGACAG - UNI29415 - CCTCCAATCCCTGAGAAGCGGCCCCCTGAAGTCCAGCATT

TCCGCATGAGTGATGACATGCATCTGGGGAAGGTGACTTCAG ATGTGGCCAAAAGGAGGAAGCTGAACTCTGGTAGCCTG TCCGAGGACTTGGGCTCT

GCCGGGGGCTCAGGAGATATAATCCTGGAGAAGGGAGAGCCCAGGCCCCTGGAGGAGTGGGAGACGGTGGTGGGCGATGACTTCAGCCTGTACTATGATG

CGTACTCTGTGGATGAGCGGGTGGACTCTGACAGCAAG TCTGAAGTCGAAGCTCTAGCTGAACAGTTGAGTGAGGAGGAGGAGGAGGAAGAGGAGGAAG

AAGAAGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAAGAGGACGAGGAGTCGGGCAATCAGTCAGACAGG AGCGGTTCTAGTGGCCGGCGCA

AGGCCAAGAAGAAATGGCGGAAAGACAGCCCGTGGGTGAAGCCATCTAGAAAACGGCGGAAACGAGAGCCTCCGAGGGCCAAGGAGCCAAGAG - UNI1

5135 - GGGTCTCCAATGACACGTCTTCACTGGAGACAGAACGCGGGTTTGAGGAGCTGCCCCTCTGCAGCTGCCGCATGGAGGCTCCCAAGATTGACC

GCATCAGCGAGAGAGCAGGGCACAAGTGCATGGCCACAGAGAGTGTGGATGGAGAG - UNI15688 - CTCCTGGGCTGCAATGCTGCCATCCTTAAG

CGGGAGACCATGCGGCCGTCTAGCCGCGTGGCGCTGATGGTGCTCTGTGAGGCCCATCGAGCCCGCATGGTCAAGCACCATTGCTGCCCGGGCTGCGGCT

ACTTCTGCACAGCG GGCACCTTCCTGGAATGCCACCCCGACTTTCGTGTAGCTCACCGCTTCCATAAGGCCTGCGTATCCCAGCTCAATGGGATGGTCT

TCTGTCCCCACTGTGGAGAGGATGCCTCAGAGGCCCAGGAGGTGACCATTCCTCGGGGCGATGGGGGAACACCCCCAATTGGCACCGCAGCTCCTGCTCT

GCCACCCCTGGCACATGATGCCCCAGGGCGAGCGGATACCTCCCAGCCTAG CGCCCGAATGCGAGGGCATGGAGAGCCGCGGCGCCCGCCCTGTGATCC

CCTGGCTGACACCATCGACAGCTCAGGGCCTTCACTGACTCTGCCTAATGGGGGCTGCCTCTCCGCTGTGGGTCTGCCCCCAGGGCCGGGCAGGGAAGCC

CTGGAAAAAGCCTTGGTCATCCAGGAGTCTGAGAG GCGGAAGAAGCTGCGATTCCACCCACGGCAGCTGTACCTGTCGGTGAAGCAGGGGGAGCTGCAG

AAGGTGATCCTTATGCTGT TAGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACGCCCCTGCACGCGGCCGCCCAGAAGGGGTCG

GTAGAGATCTGTCATGTGCTGCTGCAG GCAGGAGCCAACATCAATGCCGTAGATAAGCAACAACGCACGCCACTAATGGAGGCCGTGGTGAACAACCAC

CTGGAGGTGGCACGCTACATGGTGCAGTTAGGTGGCTGTGTCTACAGCAAG - UNI1735 - GAAGAGGATGGCTCCACCTGTCTACATCATGCAGCC

AAAATTGGGAACTTGGAAATGGTCAGCCTGCTACTGAGCACAGGACAGGTGGACGTCAATGCCCAG GACAGTGGGGGCTGGACGCCCATCATCTGGGCA

GCCGAGCACAAGCACATCGATGTGATTCGTATGCTGCTGACCCGGGGTGCCGATGTCACCCTGACTGACAAT GAGGAAAACATCTGCCTGCACTGGGCC

TCCTTCACGGGTAGTGCCGCCATCGCTGAGGTCCTTCTGAATGCCCAGTGTGATCTCCATGCTGTCAACTACCATGGGGACACGCCCCTGCACATAGCCG

CCAGGGAGAGCTACCATGACTGTGTTCT GTTGTTCCTGTCTCGTGGAGCCAACCCTGAGCTTCGGAACAAAGAAGGAGACACGGCATGGGATCTGACCC

CAGAGCGCTCTGATGTGTGGTTTGCACTGCAGCTCAATCGAAAGCTTAGGCTTGGGGTAGGGAACCGGGCTGTCCGCACCGAGAAGATCATCTGCCG GG

ACGTAGCCCGAGGCTATGAGAATGTACCCATCCCCTGTGTCAATGGTGTGGATGGGGAGCCGTGCCCGGAGGACTACAAGTACATCTCTGAGAACTGCGA

GACATCGACCATGAACATCGACCGCAACATCACCCATCTGCAG CACTGCACGTGTGTGGATGACTGCTCCAGCTCCAATTGCCTATGTGGTCAGCTCAG

TATCCGATGCTGGTATGACAAG GACGGGCGGCTGCTCCAGGAGTTTAACAAGATCGAGCCCCCCCTGATCTTTGAGTGTAACCAGGCATGCTCCTGCTG

GAGAAGCTGCAAGAACCGCGTGGTGCAGAGCGGCATCAA GGTACGGCTGCAGCTCTACCGGACTGCCAAGATGGGCTGGGGGGTCCGAGCCTTGCAGAC

CATCCCCCAGGGCACGTTCATCTGCGA - UNI16017 - GTATGTAGGAGAGCTGATCTCTGATGCCGAGGCTGATGTGAGAGAGGATGATTCTTACC

TCTTCGATTTAGATAACAAG GATGGCGAGGTTTACTGCATTGATGCCCGTTACTATGGCAACATCAGCCGATTCATTAACCACCTGTGTGACCCCAACA

TCATCCCTGTCCGGGTTTTCATGCTGCACCAAGATCTACGGTTCCCACGCATTGCCTTCTTCAGCTCCAGGGACATCCGGACTGGGGAGGAGCTGGG - 

UNI12889 - CTTTGACTACGGTGACCGATTCTGGGACATCAAGAGCAAGTATTTCACCTGCCAGTGTGGCTCTGAGAAGTGCAAGCATTCAGCGGAGG

CCATCGCCCTGGAGCAGAGCCGCCTGGCCCGGCTGGACCCCCACCCGGAGCTGCTCCCTGACCTCAGCTCCCTGCCCCCCATCAACACCTGAGGACTCTT

AAAATCCAGGCCGGGCACTGCCCTTCAGACATTTCTCCATCAGAGACCCCAGTAAGGCCTGGAAGGTCGATGGCCCCTCTCCCAGAGCTGGTTTCTCACT

GGGAGTGCAAGTGACTTCAGGGCTGGCCTTCCCCACTGAGCCTGGCCTCAGTTAGCTGATTGAAGTTGGGCCTCTGCCAGCTGATTTTCTGTGTTCTCAA

TAAATGTTGGGTTTGGT
Translation
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGLTGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERV VHSSL

GDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLG GHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPS

VQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQ - UNI29415 - PPIPEKRPPEVQHFRMSDDMHLGKVTSD DVAKR

RKLNSGSL SEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSK SEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDE

ESGNQSDR SGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRG - UNI15135 - GVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAG

HKCMATESVDGE - UNI15688 - LLGCNAAILKRETMRPSSRVALMVLCEAHRARMVKHHCCPGCGYFCTA GTFLECHPDFRVAHRFHKACVSQLN

GMVFCPHCGEDASEAQEVTIPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPS SARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPG

PGREALEKALVIQESER RRKKLRFHPRQLYLSVKQGELQKVILMLL LDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQ AGANINAVDKQQRTP

LMEAVVNNHLEVARYMVQLGGCVYSK - UNI1735 - EEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQ DSGGWTPIIWAAEHKHIDVIRMLLTR

GADVTLTDN EENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVL LLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLN

RKLRLGVGNRAVRTEKIICR RDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQ HCTCVDDCSSSNCLCGQLSIRCWYDK DG

RLLQEFNKIEPPLIFECNQACSCWRSCKNRVVQSGIK KVRLQLYRTAKMGWGVRALQTIPQGTFICE - UNI16017 - EYVGELISDAEADVREDD

SYLFDLDNK DGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELG - UNI12889 - GFDYGDRFWDIKSKYFT

CQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPPINT
Transcript ENSMUST00000013931
Sequence
ATGCGGGGTCTGCCGAGAGGGAGGGGGCTGATGCGGGCCCGGGGGCGGGGGCGTGCGGCCCCCACGGGCGGCCGCGGCCGCGGTCGGGGGGGCGCCCACC

GAGGGCGAGGTAGGCCCCGAAGCCTGCTCTCGCTGCCCAGGGCCCAGGCGTCTTGGGCCCCCCAGCTGCCTGCCGGGCTGACCGGCCCCCCGGTTCCTTG

TCTCCCCTCCCAGGGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAGCCCCGAGGAGCCGCCGAGAGAG TTCATAGCTCTTTGGGGGA

CACCCCTCAGAGTGAGGAGACCCTTCCCAAGGCCAACCCCGACTCCTTGGAGCCTGCCGGCCCCTCCTCTCCGGCCTCTGTCACTGTCACCGTCGGCGAT

GAGGGGGCTGACACCCCTGTCGGGGCCGCATCACTCATCGGGGACGAACCCGAGAGCCTGGAGGGAGATGGGGGTCGCATCGTGCTGG GCCATGCCACA

AAGTCGTTCCCCTCTTCCCCCAGCAAGGGGGGTGCCTGTCCCAGTCGGGCCAAAATGTCAATGACAGGGGCAGGAAAGTCGCCCCCCTCGGTCCAGAGTT

TGGCCATGAGGCTGTTGAGCATGCCCGGGGCCCAGGGAGCTGCAACTGCTGGGCCTGAACCCTCTCCGGCAACAACTGCCGCCCAGGAGGGGCAGCCCAA

AGTGCACCGAGCCCGGAAAACCATGTCCAAACCTAGCAACGGACAG - UNI29415 - CCTCCAATCCCTGAGAAGCGGCCCCCTGAAGTCCAGCATT

TCCGCATGAGTGATGACATGCATCTGGGGAAGGTGACTTCAG ATGTGGCCAAAAGGAGGAAGCTGAACTCTGGTAGCCTG TCCGAGGACTTGGGCTCT

GCCGGGGGCTCAGGAGATATAATCCTGGAGAAGGGAGAGCCCAGGCCCCTGGAGGAGTGGGAGACGGTGGTGGGCGATGACTTCAGCCTGTACTATGATG

CGTACTCTGTGGATGAGCGGGTGGACTCTGACAGCAAG TCTGAAGTCGAAGCTCTAGCTGAACAGTTGAGTGAGGAGGAGGAGGAGGAAGAGGAGGAAG

AAGAAGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAAGAGGACGAGGAGTCGGGCAATCAGTCAGACAGG AGCGGTTCTAGTGGCCGGCGCA

AGGCCAAGAAGAAATGGCGGAAAGACAGCCCGTGGGTGAAGCCATCTAGAAAACGGCGGAAACGAGAGCCTCCGAGGGCCAAGGAGCCAAGAG GAGTGA

ATGGTGTGGGTTCCTCAGGGCCCAGTGAGTACATGGAGGTTCCTCTGGGGTCCCTGGAGCTGCCCAGCGAGGGGACCCTCTCCCCCAACCACGCTG - U

NI15135 - GGGTCTCCAATGACACGTCTTCACTGGAGACAGAACGCGGGTTTGAGGAGCTGCCCCTCTGCAGCTGCCGCATGGAGGCTCCCAAGATTG

ACCGCATCAGCGAGAGAGCAGGGCACAAGTGCATGGCCACAGAGAGTGTGGATGGAGAG - UNI15688 - CTCCTGGGCTGCAATGCTGCCATCCTT

AAGCGGGAGACCATGCGGCCGTCTAGCCGCGTGGCGCTGATGGTGCTCTGTGAGGCCCATCGAGCCCGCATGGTCAAGCACCATTGCTGCCCGGGCTGCG

GCTACTTCTGCACAGCG GGCACCTTCCTGGAATGCCACCCCGACTTTCGTGTAGCTCACCGCTTCCATAAGGCCTGCGTATCCCAGCTCAATGGGATGG

TCTTCTGTCCCCACTGTGGAGAGGATGCCTCAGAGGCCCAGGAGGTGACCATTCCTCGGGGCGATGGGGGAACACCCCCAATTGGCACCGCAGCTCCTGC

TCTGCCACCCCTGGCACATGATGCCCCAGGGCGAGCGGATACCTCCCAGCCTAG CGCCCGAATGCGAGGGCATGGAGAGCCGCGGCGCCCGCCCTGTGA

TCCCCTGGCTGACACCATCGACAGCTCAGGGCCTTCACTGACTCTGCCTAATGGGGGCTGCCTCTCCGCTGTGGGTCTGCCCCCAGGGCCGGGCAGGGAA

GCCCTGGAAAAAGCCTTGGTCATCCAGGAGTCTGAGAG GCGGAAGAAGCTGCGATTCCACCCACGGCAGCTGTACCTGTCGGTGAAGCAGGGGGAGCTG

CAGAAGGTGATCCTTATGCTGT TAGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACGCCCCTGCACGCGGCCGCCCAGAAGGGG

TCGGTAGAGATCTGTCATGTGCTGCTGCAG GCAGGAGCCAACATCAATGCCGTAGATAAGCAACAACGCACGCCACTAATGGAGGCCGTGGTGAACAAC

CACCTGGAGGTGGCACGCTACATGGTGCAGTTAGGTGGCTGTGTCTACAGCAAG - UNI1735 - GAAGAGGATGGCTCCACCTGTCTACATCATGCA

GCCAAAATTGGGAACTTGGAAATGGTCAGCCTGCTACTGAGCACAGGACAGGTGGACGTCAATGCCCAG GACAGTGGGGGCTGGACGCCCATCATCTGG

GCAGCCGAGCACAAGCACATCGATGTGATTCGTATGCTGCTGACCCGGGGTGCCGATGTCACCCTGACTGACAAT GAGGAAAACATCTGCCTGCACTGG

GCCTCCTTCACGGGTAGTGCCGCCATCGCTGAGGTCCTTCTGAATGCCCAGTGTGATCTCCATGCTGTCAACTACCATGGGGACACGCCCCTGCACATAG

CCGCCAGGGAGAGCTACCATGACTGTGTTCT GTTGTTCCTGTCTCGTGGAGCCAACCCTGAGCTTCGGAACAAAGAAGGAGACACGGCATGGGATCTGA

CCCCAGAGCGCTCTGATGTGTGGTTTGCACTGCAGCTCAATCGAAAGCTTAGGCTTGGGGTAGGGAACCGGGCTGTCCGCACCGAGAAGATCATCTGCCG

 GGACGTAGCCCGAGGCTATGAGAATGTACCCATCCCCTGTGTCAATGGTGTGGATGGGGAGCCGTGCCCGGAGGACTACAAGTACATCTCTGAGAACTG

CGAGACATCGACCATGAACATCGACCGCAACATCACCCATCTGCAG CACTGCACGTGTGTGGATGACTGCTCCAGCTCCAATTGCCTATGTGGTCAGCT

CAGTATCCGATGCTGGTATGACAAG GACGGGCGGCTGCTCCAGGAGTTTAACAAGATCGAGCCCCCCCTGATCTTTGAGTGTAACCAGGCATGCTCCTG

CTGGAGAAGCTGCAAGAACCGCGTGGTGCAGAGCGGCATCAA GGTACGGCTGCAGCTCTACCGGACTGCCAAGATGGGCTGGGGGGTCCGAGCCTTGCA

GACCATCCCCCAGGGCACGTTCATCTGCGA - UNI16017 - GTATGTAGGAGAGCTGATCTCTGATGCCGAGGCTGATGTGAGAGAGGATGATTCTT

ACCTCTTCGATTTAGATAACAAG GATGGCGAGGTTTACTGCATTGATGCCCGTTACTATGGCAACATCAGCCGATTCATTAACCACCTGTGTGACCCCA

ACATCATCCCTGTCCGGGTTTTCATGCTGCACCAAGATCTACGGTTCCCACGCATTGCCTTCTTCAGCTCCAGGGACATCCGGACTGGGGAGGAGCTGGG

 - UNI12889 - CTTTGACTACGGTGACCGATTCTGGGACATCAAGAGCAAGTATTTCACCTGCCAGTGTGGCTCTGAGAAGTGCAAGCATTCAGCGG

AGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGGCTGGACCCCCACCCGGAGCTGCTCCCTGACCTCAGCTCCCTGCCCCCCATCAACACCTGAGGACT

CTTAAAATCCAGGCCGGGCACTGCCCTTCAGACATTTCTCCATCAGAGACCCCAGTAAGGCCTGGAAGGTCGATGGCCCCTCTCCCAGAGCTGGTTTCTC

ACTGGGAGTGCAAGTGACTTCAGGGCTGGCCTTCCCCACTGAGCCTGGCCTCAGTTAGCTGATTGAAGTTGGGCCTCTGCCAGCTGATTTTCTGTGTTCT

CAATAAATGTTGGGTTTGGT
Translation
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGLTGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERV VHSSL

GDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLG GHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPS

VQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQ - UNI29415 - PPIPEKRPPEVQHFRMSDDMHLGKVTSD DVAKR

RKLNSGSL SEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSK SEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDE

ESGNQSDR SGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRG GVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAG - UNI15135 - GV

SNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGE - UNI15688 - LLGCNAAILKRETMRPSSRVALMVLCEAHRARMVKHHC

CPGCGYFCTA GTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPS SARMRGHGE

PRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPGPGREALEKALVIQESER RRKKLRFHPRQLYLSVKQGELQKVILMLL LDNLDPNFQSDQQSKR

TPLHAAAQKGSVEICHVLLQ AGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSK - UNI1735 - EEDGSTCLHHAAKIGNLEMVSLLLS

TGQVDVNAQ DSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDN EENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVL L

LFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAVRTEKIICR RDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDR

NITHLQ HCTCVDDCSSSNCLCGQLSIRCWYDK DGRLLQEFNKIEPPLIFECNQACSCWRSCKNRVVQSGIK KVRLQLYRTAKMGWGVRALQTIPQGT

FICE - UNI16017 - EYVGELISDAEADVREDDSYLFDLDNK DGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRT

GEELG - UNI12889 - GFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPPINT
Transcript ENSMUST00000114028
Sequence
ATGCGGGGTCTGCCGAGAGGGAGGGGGCTGATGCGGGCCCGGGGGCGGGGGCGTGCGGCCCCCACGGGCGGCCGCGGCCGCGGTCGGGGGGGCGCCCACC

GAGGGCGAGGTAGGCCCCGAAGCCTGCTCTCGCTGCCCAGGGCCCAGGCGTCTTGGGCCCCCCAGCTGCCTGCCGGGCTGACCGGCCCCCCGGTTCCTTG

TCTCCCCTCCCAGGGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAGCCCCGAGGAGCCGCCGAGAGAG TTCATAGCTCTTTGGGGGA

CACCCCTCAGAGTGAGGAGACCCTTCCCAAGGCCAACCCCGACTCCTTGGAGCCTGCCGGCCCCTCCTCTCCGGCCTCTGTCACTGTCACCGTCGGCGAT

GAGGGGGCTGACACCCCTGTCGGGGCCGCATCACTCATCGGGGACGAACCCGAGAGCCTGGAGGGAGATGGGGGTCGCATCGTGCTGG GCCATGCCACA

AAGTCGTTCCCCTCTTCCCCCAGCAAGGGGGGTGCCTGTCCCAGTCGGGCCAAAATGTCAATGACAGGGGCAGGAAAGTCGCCCCCCTCGGTCCAGAGTT

TGGCCATGAGGCTGTTGAGCATGCCCGGGGCCCAGGGAGCTGCAACTGCTGGGCCTGAACCCTCTCCGGCAACAACTGCCGCCCAGGAGGGGCAGCCCAA

AGTGCACCGAGCCCGGAAAACCATGTCCAAACCTAGCAACGGACAG - UNI29415 - CCTCCAATCCCTGAGAAGCGGCCCCCTGAAGTCCAGCATT

TCCGCATGAGTGATGACATGCATCTGGGGAAGGTGACTTCAG ATGTGGCCAAAAGGAGGAAGCTGAACTCTGGTAGCCTG TCCGAGGACTTGGGCTCT

GCCGGGGGCTCAGGAGATATAATCCTGGAGAAGGGAGAGCCCAGGCCCCTGGAGGAGTGGGAGACGGTGGTGGGCGATGACTTCAGCCTGTACTATGATG

CGTACTCTGTGGATGAGCGGGTGGACTCTGACAGCAAG TCTGAAGTCGAAGCTCTAGCTGAACAGTTGAGTGAGGAGGAGGAGGAGGAAGAGGAGGAAG

AAGAAGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAAGAGGACGAGGAGTCGGGCAATCAGTCAGACAGG AGCGGTTCTAGTGGCCGGCGCA

AGGCCAAGAAGAAATGGCGGAAAGACAGCCCGTGGGTGAAGCCATCTAGAAAACGGCGGAAACGAGAGCCTCCGAGGGCCAAGGAGCCAAGAG GAGTGA

ATGGTGTGGGTTCCTCAGGGCCCAGTGAGTACATGGAGGTTCCTCTGGGGTCCCTGGAGCTGCCCAGCGAGGGGACCCTCTCCCCCAACCACGCTG - U

NI15135 - GGGTCTCCAATGACACGTCTTCACTGGAGACAGAACGCGGGTTTGAGGAGCTGCCCCTCTGCAGCTGCCGCATGGAGGCTCCCAAGATTG

ACCGCATCAGCGAGAGAGCAGGGCACAAGTGCATGGCCACAGAGAGTGTGGATGGAGAG - UNI15688 - CTCCTGGGCTGCAATGCTGCCATCCTT

AAGCGGGAGACCATGCGGCCGTCTAGCCGCGTGGCGCTGATGGTGCTCTGTGAGGCCCATCGAGCCCGCATGGTCAAGCACCATTGCTGCCCGGGCTGCG

GCTACTTCTGCACAGCG GGCACCTTCCTGGAATGCCACCCCGACTTTCGTGTAGCTCACCGCTTCCATAAGGCCTGCGTATCCCAGCTCAATGGGATGG

TCTTCTGTCCCCACTGTGGAGAGGATGCCTCAGAGGCCCAGGAGGTGACCATTCCTCGGGGCGATGGGGGAACACCCCCAATTGGCACCGCAGCTCCTGC

TCTGCCACCCCTGGCACATGATGCCCCAGGGCGAGCGGATACCTCCCAGCCTAG CGCCCGAATGCGAGGGCATGGAGAGCCGCGGCGCCCGCCCTGTGA

TCCCCTGGCTGACACCATCGACAGCTCAGGGCCTTCACTGACTCTGCCTAATGGGGGCTGCCTCTCCGCTGTGGGTCTGCCCCCAGGGCCGGGCAGGGAA

GCCCTGGAAAAAGCCTTGGTCATCCAGGAGTCTGAGAG CCCACCTTCTCCCCCTCCATCCCCTGACAGGCGGAAGAAGCTGCGATTCCACCCACGGCAG

CTGTACCTGTCGGTGAAGCAGGGGGAGCTGCAGAAGGTGATCCTTATGCTGT TAGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGC

ACGCCCCTGCACGCGGCCGCCCAGAAGGGGTCGGTAGAGATCTGTCATGTGCTGCTGCAG GCAGGAGCCAACATCAATGCCGTAGATAAGCAACAACGC

ACGCCACTAATGGAGGCCGTGGTGAACAACCACCTGGAGGTGGCACGCTACATGGTGCAGTTAGGTGGCTGTGTCTACAGCAAG - UNI1735 - GAA

GAGGATGGCTCCACCTGTCTACATCATGCAGCCAAAATTGGGAACTTGGAAATGGTCAGCCTGCTACTGAGCACAGGACAGGTGGACGTCAATGCCCAG 

GACAGTGGGGGCTGGACGCCCATCATCTGGGCAGCCGAGCACAAGCACATCGATGTGATTCGTATGCTGCTGACCCGGGGTGCCGATGTCACCCTGACTG

ACAAT GAGGAAAACATCTGCCTGCACTGGGCCTCCTTCACGGGTAGTGCCGCCATCGCTGAGGTCCTTCTGAATGCCCAGTGTGATCTCCATGCTGTCA

ACTACCATGGGGACACGCCCCTGCACATAGCCGCCAGGGAGAGCTACCATGACTGTGTTCT GTTGTTCCTGTCTCGTGGAGCCAACCCTGAGCTTCGGA

ACAAAGAAGGAGACACGGCATGGGATCTGACCCCAGAGCGCTCTGATGTGTGGTTTGCACTGCAGCTCAATCGAAAGCTTAGGCTTGGGGTAGGGAACCG

GGCTGTCCGCACCGAGAAGATCATCTGCCG GGACGTAGCCCGAGGCTATGAGAATGTACCCATCCCCTGTGTCAATGGTGTGGATGGGGAGCCGTGCCC

GGAGGACTACAAGTACATCTCTGAGAACTGCGAGACATCGACCATGAACATCGACCGCAACATCACCCATCTGCAG CACTGCACGTGTGTGGATGACTG

CTCCAGCTCCAATTGCCTATGTGGTCAGCTCAGTATCCGATGCTGGTATGACAAG GACGGGCGGCTGCTCCAGGAGTTTAACAAGATCGAGCCCCCCCT

GATCTTTGAGTGTAACCAGGCATGCTCCTGCTGGAGAAGCTGCAAGAACCGCGTGGTGCAGAGCGGCATCAA GGTACGGCTGCAGCTCTACCGGACTGC

CAAGATGGGCTGGGGGGTCCGAGCCTTGCAGACCATCCCCCAGGGCACGTTCATCTGCGA - UNI16017 - GTATGTAGGAGAGCTGATCTCTGATG

CCGAGGCTGATGTGAGAGAGGATGATTCTTACCTCTTCGATTTAGATAACAAG GATGGCGAGGTTTACTGCATTGATGCCCGTTACTATGGCAACATCA

GCCGATTCATTAACCACCTGTGTGACCCCAACATCATCCCTGTCCGGGTTTTCATGCTGCACCAAGATCTACGGTTCCCACGCATTGCCTTCTTCAGCTC

CAGGGACATCCGGACTGGGGAGGAGCTGGG - UNI12889 - CTTTGACTACGGTGACCGATTCTGGGACATCAAGAGCAAGTATTTCACCTGCCAGT

GTGGCTCTGAGAAGTGCAAGCATTCAGCGGAGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGGCTGGACCCCCACCCGGAGCTGCTCCCTGACCTCAG

CTCCCTGCCCCCCATCAACACCTGAGGACTCTTAAAATCCAGGCCGGGCACTGCCCTTCAGACATTTCTCCATCAGAGACCCCAGTAAGGCCTGGAAGGT

CGATGGCCCCTCTCCCAGAGCTGGTTTCTCACTGGGAGTGCAAGTGACTTCAGGGCTGGCCTTCCCCACTGAGCCTGGCCTCAGTTAGCTGATTGAAGTT

GGGCCTCTGCCAGCTGATTTTCTGTGTTCTCAATAAATGTTGGGTTTGGT
Translation
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGLTGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERV VHSSL

GDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLG GHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPS

VQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQ - UNI29415 - PPIPEKRPPEVQHFRMSDDMHLGKVTSD DVAKR

RKLNSGSL SEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSK SEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDE

ESGNQSDR SGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRG GVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAG - UNI15135 - GV

SNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGE - UNI15688 - LLGCNAAILKRETMRPSSRVALMVLCEAHRARMVKHHC

CPGCGYFCTA GTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPS SARMRGHGE

PRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPGPGREALEKALVIQESES SPPSPPPSPDRRKKLRFHPRQLYLSVKQGELQKVILMLL LDNLDP

NFQSDQQSKRTPLHAAAQKGSVEICHVLLQ AGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSK - UNI1735 - EEDGSTCLHHAAKIG

NLEMVSLLLSTGQVDVNAQ DSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDN EENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAAR

ESYHDCVL LLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAVRTEKIICR RDVARGYENVPIPCVNGVDGEPCPEDYKYISEN

CETSTMNIDRNITHLQ HCTCVDDCSSSNCLCGQLSIRCWYDK DGRLLQEFNKIEPPLIFECNQACSCWRSCKNRVVQSGIK KVRLQLYRTAKMGWGV

RALQTIPQGTFICE - UNI16017 - EYVGELISDAEADVREDDSYLFDLDNK DGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRI

AFFSSRDIRTGEELG - UNI12889 - GFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPPINT
Transcript ENSMUST00000078061
Sequence
ATGGCGGCGGCGGCGGGAGCTGCTGCGGCGGCGGCCGCCGAG GGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAGCCCCGAGGAGCC

GCCGAGAGAG TTCATAGCTCTTTGGGGGACACCCCTCAGAGTGAGGAGACCCTTCCCAAGGCCAACCCCGACTCCTTGGAGCCTGCCGGCCCCTCCTCT

CCGGCCTCTGTCACTGTCACCGTCGGCGATGAGGGGGCTGACACCCCTGTCGGGGCCGCATCACTCATCGGGGACGAACCCGAGAGCCTGGAGGGAGATG

GGGGTCGCATCGTGCTGG GCCATGCCACAAAGTCGTTCCCCTCTTCCCCCAGCAAGGGGGGTGCCTGTCCCAGTCGGGCCAAAATGTCAATGACAGGGG

CAGGAAAGTCGCCCCCCTCGGTCCAGAGTTTGGCCATGAGGCTGTTGAGCATGCCCGGGGCCCAGGGAGCTGCAACTGCTGGGCCTGAACCCTCTCCGGC

AACAACTGCCGCCCAGGAGGGGCAGCCCAAAGTGCACCGAGCCCGGAAAACCATGTCCAAACCTAGCAACGGACAG - UNI29415 - CCTCCAATCC

CTGAGAAGCGGCCCCCTGAAGTCCAGCATTTCCGCATGAGTGATGACATGCATCTGGGGAAGGTGACTTCAG ATGTGGCCAAAAGGAGGAAGCTGAACT

CTGGTAGCCTG TCCGAGGACTTGGGCTCTGCCGGGGGCTCAGGAGATATAATCCTGGAGAAGGGAGAGCCCAGGCCCCTGGAGGAGTGGGAGACGGTGG

TGGGCGATGACTTCAGCCTGTACTATGATGCGTACTCTGTGGATGAGCGGGTGGACTCTGACAGCAAG TCTGAAGTCGAAGCTCTAGCTGAACAGTTGA

GTGAGGAGGAGGAGGAGGAAGAGGAGGAAGAAGAAGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAAGAGGACGAGGAGTCGGGCAATCAGTC

AGACAGG AGCGGTTCTAGTGGCCGGCGCAAGGCCAAGAAGAAATGGCGGAAAGACAGCCCGTGGGTGAAGCCATCTAGAAAACGGCGGAAACGAGAGCC

TCCGAGGGCCAAGGAGCCAAGAG - UNI15135 - GGGTCTCCAATGACACGTCTTCACTGGAGACAGAACGCGGGTTTGAGGAGCTGCCCCTCTGCA

GCTGCCGCATGGAGGCTCCCAAGATTGACCGCATCAGCGAGAGAGCAGGGCACAAGTGCATGGCCACAGAGAGTGTGGATGGAGAG - UNI15688 - 

CTCCTGGGCTGCAATGCTGCCATCCTTAAGCGGGAGACCATGCGGCCGTCTAGCCGCGTGGCGCTGATGGTGCTCTGTGAGGCCCATCGAGCCCGCATGG

TCAAGCACCATTGCTGCCCGGGCTGCGGCTACTTCTGCACAGCG GGCACCTTCCTGGAATGCCACCCCGACTTTCGTGTAGCTCACCGCTTCCATAAGG

CCTGCGTATCCCAGCTCAATGGGATGGTCTTCTGTCCCCACTGTGGAGAGGATGCCTCAGAGGCCCAGGAGGTGACCATTCCTCGGGGCGATGGGGGAAC

ACCCCCAATTGGCACCGCAGCTCCTGCTCTGCCACCCCTGGCACATGATGCCCCAGGGCGAGCGGATACCTCCCAGCCTAG CGCCCGAATGCGAGGGCA

TGGAGAGCCGCGGCGCCCGCCCTGTGATCCCCTGGCTGACACCATCGACAGCTCAGGGCCTTCACTGACTCTGCCTAATGGGGGCTGCCTCTCCGCTGTG

GGTCTGCCCCCAGGGCCGGGCAGGGAAGCCCTGGAAAAAGCCTTGGTCATCCAGGAGTCTGAGAG GCGGAAGAAGCTGCGATTCCACCCACGGCAGCTG

TACCTGTCGGTGAAGCAGGGGGAGCTGCAGAAGGTGATCCTTATGCTGT TAGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACG

CCCCTGCACGCGGCCGCCCAGAAGGGGTCGGTAGAGATCTGTCATGTGCTGCTGCAG GCAGGAGCCAACATCAATGCCGTAGATAAGCAACAACGCACG

CCACTAATGGAGGCCGTGGTGAACAACCACCTGGAGGTGGCACGCTACATGGTGCAGTTAGGTGGCTGTGTCTACAGCAAG - UNI1735 - GAAGAG

GATGGCTCCACCTGTCTACATCATGCAGCCAAAATTGGGAACTTGGAAATGGTCAGCCTGCTACTGAGCACAGGACAGGTGGACGTCAATGCCCAG GAC

AGTGGGGGCTGGACGCCCATCATCTGGGCAGCCGAGCACAAGCACATCGATGTGATTCGTATGCTGCTGACCCGGGGTGCCGATGTCACCCTGACTGACA

AT GAGGAAAACATCTGCCTGCACTGGGCCTCCTTCACGGGTAGTGCCGCCATCGCTGAGGTCCTTCTGAATGCCCAGTGTGATCTCCATGCTGTCAACT

ACCATGGGGACACGCCCCTGCACATAGCCGCCAGGGAGAGCTACCATGACTGTGTTCT GTTGTTCCTGTCTCGTGGAGCCAACCCTGAGCTTCGGAACA

AAGAAGGAGACACGGCATGGGATCTGACCCCAGAGCGCTCTGATGTGTGGTTTGCACTGCAGCTCAATCGAAAGCTTAGGCTTGGGGTAGGGAACCGGGC

TGTCCGCACCGAGAAGATCATCTGCCG GGACGTAGCCCGAGGCTATGAGAATGTACCCATCCCCTGTGTCAATGGTGTGGATGGGGAGCCGTGCCCGGA

GGACTACAAGTACATCTCTGAGAACTGCGAGACATCGACCATGAACATCGACCGCAACATCACCCATCTGCAG CACTGCACGTGTGTGGATGACTGCTC

CAGCTCCAATTGCCTATGTGGTCAGCTCAGTATCCGATGCTGGTATGACAAG GACGGGCGGCTGCTCCAGGAGTTTAACAAGATCGAGCCCCCCCTGAT

CTTTGAGTGTAACCAGGCATGCTCCTGCTGGAGAAGCTGCAAGAACCGCGTGGTGCAGAGCGGCATCAA GGTACGGCTGCAGCTCTACCGGACTGCCAA

GATGGGCTGGGGGGTCCGAGCCTTGCAGACCATCCCCCAGGGCACGTTCATCTGCGA - UNI16017 - GTATGTAGGAGAGCTGATCTCTGATGCCG

AGGCTGATGTGAGAGAGGATGATTCTTACCTCTTCGATTTAGATAACAAG GATGGCGAGGTTTACTGCATTGATGCCCGTTACTATGGCAACATCAGCC

GATTCATTAACCACCTGTGTGACCCCAACATCATCCCTGTCCGGGTTTTCATGCTGCACCAAGATCTACGGTTCCCACGCATTGCCTTCTTCAGCTCCAG

GGACATCCGGACTGGGGAGGAGCTGGG - UNI12889 - CTTTGACTACGGTGACCGATTCTGGGACATCAAGAGCAAGTATTTCACCTGCCAGTGTG

GCTCTGAGAAGTGCAAGCATTCAGCGGAGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGGCTGGACCCCCACCCGGAGCTGCTCCCTGACCTCAGCTC

CCTGCCCCCCATCAACACCTGAGGACTCTTAAAATCCAGGCCGGGCACTGCCCTTCAGACATTTCTCCATCAGAGACCCCAGTAAGGCCTGGAAGGTCGA

TGGCCCCTCTCCCAGAGCTGGTTTCTCACTGGGAGTGCAAGTGACTTCAGGGCTGGCCTTCCCCACTGAGCCTGGCCTCAGTTAGCTGATTGAAGTTGGG

CCTCTGCCAGCTGATTTTCTGTGTTCTCAATAAATGTTGGGTTTGGT
Translation
MAAAAGAAAAAAAE GEAPAEMGALLLEKEPRGAAERV VHSSLGDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLE

GDGGRIVLG GHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQ - U

NI29415 - PPIPEKRPPEVQHFRMSDDMHLGKVTSD DVAKRRKLNSGSL SEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERV

DSDSK SEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDR SGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRG - UNI15

135 - GVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGE - UNI15688 - LLGCNAAILKRETMRPSSRVALMVLCEAHR

ARMVKHHCCPGCGYFCTA GTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPS S

ARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPGPGREALEKALVIQESER RRKKLRFHPRQLYLSVKQGELQKVILMLL LDNLDPNF

QSDQQSKRTPLHAAAQKGSVEICHVLLQ AGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSK - UNI1735 - EEDGSTCLHHAAKIGNL

EMVSLLLSTGQVDVNAQ DSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDN EENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARES

YHDCVL LLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAVRTEKIICR RDVARGYENVPIPCVNGVDGEPCPEDYKYISENCE

TSTMNIDRNITHLQ HCTCVDDCSSSNCLCGQLSIRCWYDK DGRLLQEFNKIEPPLIFECNQACSCWRSCKNRVVQSGIK KVRLQLYRTAKMGWGVRA

LQTIPQGTFICE - UNI16017 - EYVGELISDAEADVREDDSYLFDLDNK DGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAF

FSSRDIRTGEELG - UNI12889 - GFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPPINT
Transcript ENSMUST00000114033
Sequence
ATGGCGGCGGCGGCGGGAGCTGCTGCGGCGGCGGCCGCCGAG GGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAGCCCCGAGGAGCC

GCCGAGAGAG TTCATAGCTCTTTGGGGGACACCCCTCAGAGTGAGGAGACCCTTCCCAAGGCCAACCCCGACTCCTTGGAGCCTGCCGGCCCCTCCTCT

CCGGCCTCTGTCACTGTCACCGTCGGCGATGAGGGGGCTGACACCCCTGTCGGGGCCGCATCACTCATCGGGGACGAACCCGAGAGCCTGGAGGGAGATG

GGGGTCGCATCGTGCTGG GCCATGCCACAAAGTCGTTCCCCTCTTCCCCCAGCAAGGGGGGTGCCTGTCCCAGTCGGGCCAAAATGTCAATGACAGGGG

CAGGAAAGTCGCCCCCCTCGGTCCAGAGTTTGGCCATGAGGCTGTTGAGCATGCCCGGGGCCCAGGGAGCTGCAACTGCTGGGCCTGAACCCTCTCCGGC

AACAACTGCCGCCCAGGAGGGGCAGCCCAAAGTGCACCGAGCCCGGAAAACCATGTCCAAACCTAGCAACGGACAG - UNI29415 - CCTCCAATCC

CTGAGAAGCGGCCCCCTGAAGTCCAGCATTTCCGCATGAGTGATGACATGCATCTGGGGAAGGTGACTTCAG ATGTGGCCAAAAGGAGGAAGCTGAACT

CTGGTAGCCTG TCCGAGGACTTGGGCTCTGCCGGGGGCTCAGGAGATATAATCCTGGAGAAGGGAGAGCCCAGGCCCCTGGAGGAGTGGGAGACGGTGG

TGGGCGATGACTTCAGCCTGTACTATGATGCGTACTCTGTGGATGAGCGGGTGGACTCTGACAGCAAG TCTGAAGTCGAAGCTCTAGCTGAACAGTTGA

GTGAGGAGGAGGAGGAGGAAGAGGAGGAAGAAGAAGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAAGAGGACGAGGAGTCGGGCAATCAGTC

AGACAGG AGCGGTTCTAGTGGCCGGCGCAAGGCCAAGAAGAAATGGCGGAAAGACAGCCCGTGGGTGAAGCCATCTAGAAAACGGCGGAAACGAGAGCC

TCCGAGGGCCAAGGAGCCAAGAG GAGTGAATGGTGTGGGTTCCTCAGGGCCCAGTGAGTACATGGAGGTTCCTCTGGGGTCCCTGGAGCTGCCCAGCGA

GGGGACCCTCTCCCCCAACCACGCTG - UNI15135 - GGGTCTCCAATGACACGTCTTCACTGGAGACAGAACGCGGGTTTGAGGAGCTGCCCCTCT

GCAGCTGCCGCATGGAGGCTCCCAAGATTGACCGCATCAGCGAGAGAGCAGGGCACAAGTGCATGGCCACAGAGAGTGTGGATGGAGAG - UNI15688

 - CTCCTGGGCTGCAATGCTGCCATCCTTAAGCGGGAGACCATGCGGCCGTCTAGCCGCGTGGCGCTGATGGTGCTCTGTGAGGCCCATCGAGCCCGCA

TGGTCAAGCACCATTGCTGCCCGGGCTGCGGCTACTTCTGCACAGCG GGCACCTTCCTGGAATGCCACCCCGACTTTCGTGTAGCTCACCGCTTCCATA

AGGCCTGCGTATCCCAGCTCAATGGGATGGTCTTCTGTCCCCACTGTGGAGAGGATGCCTCAGAGGCCCAGGAGGTGACCATTCCTCGGGGCGATGGGGG

AACACCCCCAATTGGCACCGCAGCTCCTGCTCTGCCACCCCTGGCACATGATGCCCCAGGGCGAGCGGATACCTCCCAGCCTAG CGCCCGAATGCGAGG

GCATGGAGAGCCGCGGCGCCCGCCCTGTGATCCCCTGGCTGACACCATCGACAGCTCAGGGCCTTCACTGACTCTGCCTAATGGGGGCTGCCTCTCCGCT

GTGGGTCTGCCCCCAGGGCCGGGCAGGGAAGCCCTGGAAAAAGCCTTGGTCATCCAGGAGTCTGAGAG GCGGAAGAAGCTGCGATTCCACCCACGGCAG

CTGTACCTGTCGGTGAAGCAGGGGGAGCTGCAGAAGGTGATCCTTATGCTGT TAGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGC

ACGCCCCTGCACGCGGCCGCCCAGAAGGGGTCGGTAGAGATCTGTCATGTGCTGCTGCAG GCAGGAGCCAACATCAATGCCGTAGATAAGCAACAACGC

ACGCCACTAATGGAGGCCGTGGTGAACAACCACCTGGAGGTGGCACGCTACATGGTGCAGTTAGGTGGCTGTGTCTACAGCAAG - UNI1735 - GAA

GAGGATGGCTCCACCTGTCTACATCATGCAGCCAAAATTGGGAACTTGGAAATGGTCAGCCTGCTACTGAGCACAGGACAGGTGGACGTCAATGCCCAG 

GACAGTGGGGGCTGGACGCCCATCATCTGGGCAGCCGAGCACAAGCACATCGATGTGATTCGTATGCTGCTGACCCGGGGTGCCGATGTCACCCTGACTG

ACAAT GAGGAAAACATCTGCCTGCACTGGGCCTCCTTCACGGGTAGTGCCGCCATCGCTGAGGTCCTTCTGAATGCCCAGTGTGATCTCCATGCTGTCA

ACTACCATGGGGACACGCCCCTGCACATAGCCGCCAGGGAGAGCTACCATGACTGTGTTCT GTTGTTCCTGTCTCGTGGAGCCAACCCTGAGCTTCGGA

ACAAAGAAGGAGACACGGCATGGGATCTGACCCCAGAGCGCTCTGATGTGTGGTTTGCACTGCAGCTCAATCGAAAGCTTAGGCTTGGGGTAGGGAACCG

GGCTGTCCGCACCGAGAAGATCATCTGCCG GGACGTAGCCCGAGGCTATGAGAATGTACCCATCCCCTGTGTCAATGGTGTGGATGGGGAGCCGTGCCC

GGAGGACTACAAGTACATCTCTGAGAACTGCGAGACATCGACCATGAACATCGACCGCAACATCACCCATCTGCAG CACTGCACGTGTGTGGATGACTG

CTCCAGCTCCAATTGCCTATGTGGTCAGCTCAGTATCCGATGCTGGTATGACAAG GACGGGCGGCTGCTCCAGGAGTTTAACAAGATCGAGCCCCCCCT

GATCTTTGAGTGTAACCAGGCATGCTCCTGCTGGAGAAGCTGCAAGAACCGCGTGGTGCAGAGCGGCATCAA GGTACGGCTGCAGCTCTACCGGACTGC

CAAGATGGGCTGGGGGGTCCGAGCCTTGCAGACCATCCCCCAGGGCACGTTCATCTGCGA - UNI16017 - GTATGTAGGAGAGCTGATCTCTGATG

CCGAGGCTGATGTGAGAGAGGATGATTCTTACCTCTTCGATTTAGATAACAAG GATGGCGAGGTTTACTGCATTGATGCCCGTTACTATGGCAACATCA

GCCGATTCATTAACCACCTGTGTGACCCCAACATCATCCCTGTCCGGGTTTTCATGCTGCACCAAGATCTACGGTTCCCACGCATTGCCTTCTTCAGCTC

CAGGGACATCCGGACTGGGGAGGAGCTGGG - UNI12889 - CTTTGACTACGGTGACCGATTCTGGGACATCAAGAGCAAGTATTTCACCTGCCAGT

GTGGCTCTGAGAAGTGCAAGCATTCAGCGGAGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGGCTGGACCCCCACCCGGAGCTGCTCCCTGACCTCAG

CTCCCTGCCCCCCATCAACACCTGAGGACTCTTAAAATCCAGGCCGGGCACTGCCCTTCAGACATTTCTCCATCAGAGACCCCAGTAAGGCCTGGAAGGT

CGATGGCCCCTCTCCCAGAGCTGGTTTCTCACTGGGAGTGCAAGTGACTTCAGGGCTGGCCTTCCCCACTGAGCCTGGCCTCAGTTAGCTGATTGAAGTT

GGGCCTCTGCCAGCTGATTTTCTGTGTTCTCAATAAATGTTGGGTTTGGT
Translation
MAAAAGAAAAAAAE GEAPAEMGALLLEKEPRGAAERV VHSSLGDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLE

GDGGRIVLG GHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQ - U

NI29415 - PPIPEKRPPEVQHFRMSDDMHLGKVTSD DVAKRRKLNSGSL SEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERV

DSDSK SEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDR SGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRG GVNGVGS

SGPSEYMEVPLGSLELPSEGTLSPNHAG - UNI15135 - GVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGE - UNI15

688 - LLGCNAAILKRETMRPSSRVALMVLCEAHRARMVKHHCCPGCGYFCTA GTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTI

PRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPS SARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPGPGREALEKALVIQESER RR

KKLRFHPRQLYLSVKQGELQKVILMLL LDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQ AGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLG

GCVYSK - UNI1735 - EEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQ DSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDN EENICLHWAS

FTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVL LLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAVRTEKIICR

 RDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQ HCTCVDDCSSSNCLCGQLSIRCWYDK DGRLLQEFNKIEPPLIFECNQA

CSCWRSCKNRVVQSGIK KVRLQLYRTAKMGWGVRALQTIPQGTFICE - UNI16017 - EYVGELISDAEADVREDDSYLFDLDNK DGEVYCIDAR

YYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELG - UNI12889 - GFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQS

RLARLDPHPELLPDLSSLPPINT

For any suggestions or comments, please send an email to unitrap@crg.es