Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013936 (Myl2)
Chromosomal location
Chr 5: 122550966 - 122563481 (+)
Description
myosin, light polypeptide 2, regulatory, cardiac, slow Gene [Source:MGI (curated);Acc:Myl2-012]
RefSeq_dna
NM_010861 
RefSeq_peptide
NP_034991.3 
MGI
MGI:97272 
Uniprot/SWISSPROT
P51667 
Uniprot/SPTREMBL
Q9EQ12 
Human Ortholog
ENSG00000111245 (MYL2)
Omim 608758 - CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 10  
UniTrap UNI18982
Vector Insertion
Chr 5: 122553945 - 122554835
Public Clones not available
Private Clones OST407758 (lexicon) OST17146 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13867
Vector Insertion
Chr 5: 122556864 - 122563157
Public Clones CMHD-GT_217F12-3 (cmhd) CMHD-GT_406D10-3 (cmhd) CMHD-GT_152C7-3 (cmhd) CMHD-GT_415B6-3 (cmhd)
Private Clones OST24760 (lexicon) OST24692 (lexicon) OST15681 (lexicon) OST14197 (lexicon)
OST1208 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000014080
Sequence
AGCAGGCTCCTCGAACTCTCCAGAGGTGGCAACTGGCCTCAGACACCATG GCACCAAAGAAAGCCAAGAAGCGGATAGAAGGCGGGAGCTCCAACGTGT

TCTCCATGTTTGAGCAGACCCAGATCCAGGAGTTCAAGGAA GCCTTCACAATCATGGACCAGAACAGAGACGGCTTCATCGACAAGAATGACCTAAGGG

ACACATTTGCTGCCCTAG GACGAGTGAACGTGAAAAATGAAGAGATCGATGAAATGATCAAAGAGGCTCCAGGTCCAATTAACTTCACCGTGTTCCTCA

CGATGTTTGGGGAGAAACTTAAAG - UNI18982 - GGGCTGATCCTGAAGAGACCATTCTCAACGCATTCAAGGTGTTTGATCCCGAGGGCAAAGGG

TCACTGAAGGCTGACTA TGTCCGGGAGATGCTGACCACACAAGCAGAGAGGTTCTCCAAAGAGGAG ATCGACCAGATGTTCGCAGCCTTTCCCCCTGA

CGTCACCGGCAATCTTGATTATAAGAATTTGGTCCACATCATTACCCACGGAGAAGAGAAGGACTGAGCCCTGAACCACAGCCTCAGGTGACCCACAGCC

CACTCTCCATCCCAGGGCTGTGCGCAAATAAACAGGAAGTCTTGGCTCTGGC
Translation
M APKKAKKRIEGGSSNVFSMFEQTQIQEFKE AFTIMDQNRDGFIDKNDLRDTFAALG GRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKG - U

NI18982 - GADPEETILNAFKVFDPEGKGSLKADY YVREMLTTQAERFSKEE IDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Transcript ENSMUST00000111751
Sequence
AGGCTCCTCGAACTCTCCAGAGGTGGCAACTGGCCTCAGACACCATG GCACCAAAGAAAGCCAAGAAGCGGATAGAAGGCGGGAGCTCCAACGTGTTCT

CCATGTTTGAGCAGACCCAGATCCAGGAGTTCAAGGAA GCCTTCACAATCATGGACCAGAACAGAGACGGCTTCATCGACAAGAATGACCTAAGGGACA

CATTTGCTGCCCTAG GACGAGTGAACGTGAAAAATGAAGAGATCGATGAAATGATCAAAGAGGCTCCAGGTCCAATTAACTTCACCGTGTTCCTCACGA

TGTTTGGGGAGAAACTTAAAG - UNI18982 - GGGCTGATCCTGAAGAGACCATTCTCAACGCATTCAAGGTGTTTGATCCCGAGGGCAAAGGGTCA

CTGAAGGCTGACTA TGTCCGGGAGATGCTGACCACACAAGCAGAGAGGTTCTCCAAAGAGGAG ATCGACCAGATGTTCGCAGCCTTTCCCCCTGACGT

CACCGGCAATCTTGATTATAAGAATTTGGTCCACATCATTACCCACGGAGAAGAGAAGGACTGAGCCCTGAACCACAGCCTCAG - UNI13867 - GA

TGCTCCGGGTGCCCTCATGGGAGGTCTGCTGCTGTGACCGCAAGTTGATGATGTCATCCTGCTCAGACAGACGAGAACCAGTAGGAGAAGATGGGAGTTG

CCCTCATCCACTGTATCCAACCCTACTCCATGTGGGGTAACCCATCAAGGAGTCGCCCCTGTCCCCACCTTCTCCTCAGGCATTCTATTCTTCATCCTCT

GAGAATCATCTAGAACTATCTAGTGCAGTAGCTCTCAACCTTCCTAATGCCTCGACCCTTTAATATAGTTCCTTCATGTTGTGGTGACTCCCCAAACATA

AAATTATTTCTGTCGCTACTTC
Translation
M APKKAKKRIEGGSSNVFSMFEQTQIQEFKE AFTIMDQNRDGFIDKNDLRDTFAALG GRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKG - U

NI18982 - GADPEETILNAFKVFDPEGKGSLKADY YVREMLTTQAERFSKEE IDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD - UNI13867 

- 
Transcript ENSMUST00000111750
Sequence
GTTCCACAGCAGGGGCAGAGGCCAGCAGGCTCCTCGAACTCTCCAGAGGTGGCAACTGGCCTCAGACACCATG GCACCAAAGAAAGCCAAGAAGCGGAT

AGAAGGCGGGAGCTCCAACGTGTTCTCCATGTTTGAGCAGACCCAGATCCAGGAGTTCAAGGAA GCCTTCACAATCATGGACCAGAACAGAGACGGCTT

CATCGACAAGAATGACCTAAGGGACACATTTGCTGCCCTAG GACGAGTGAACGTGAAAAATGAAGAGATCGATGAAATGATCAAAGAGGCTCCAGGTCC

AATTAACTTCACCGTGTTCCTCACGATGTTTGGGGAGAAACTTAAAG - UNI18982 - GGGCTGATCCTGAAGAGACCATTCTCAACGCATTCAAGG

TGTTTGATCCCGAGGGCAAAGGGTCACTGAAGGCTGACTA TGTCCGGGAGATGCTGACCACACAAGCAGAGAGGTTCTCCAAAGAGGAGGTACAGGGTC

TCCAGTGTTCCCACCACCCAGCCCCCTTTATAGACACCCCGTCTCGACCTAGTGACATCCCTAGTGGTTCTAGTGAGAGCCAGCTATCAACCCCTCACTC

ACGGGACTTCCGTCTTTGACCTCACTGTATCTGTGTACCTCGGTCTCCCTGTCTGTCAAGGAGGGATGACGACATCTGCTGTCACATGCCACAAGGCTTG

ATGGTGGTCACAATACCCATTGCCACCACAGGGCCGGGCCACAGTGT
Translation
M APKKAKKRIEGGSSNVFSMFEQTQIQEFKE AFTIMDQNRDGFIDKNDLRDTFAALG GRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKG - U

NI18982 - GADPEETILNAFKVFDPEGKGSLKADY YVREMLTTQAERFSKEEVQGLQCSHHPAPFIDTPSRPSDIPSGSSESQLSTPHSRDFRL

For any suggestions or comments, please send an email to unitrap@crg.es