Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000013997 (Nit1)
Chromosomal location
Chr 1: 173268139 - 173275777 (-)
Description
nitrilase 1 Gene [Source:MGI (curated);Acc:Nit1-003]
RefSeq_dna
NM_012049 
RefSeq_peptide
NP_036179.1 
UniGene
Mm.440362 Mm.472271 
MGI
MGI:1350916 
Uniprot/SWISSPROT
Q8VDK1 
Uniprot/SPTREMBL
Q9R1N4 
Human Ortholog
ENSG00000158793 (NIT1)
Omim not available
UniTrap UNI23479
Vector Insertion
Chr 1: 173275044 - 173275132
Public Clones not available
Private Clones OST257937 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111296
Sequence
CTCCTGGCTCCTGGCAGCTCTTGAGATCCGACCCCGTGAATGGTTTTGGCTGTGTCTTCAT - UNI23479 - GCTGGGCTTCATCACCAGGCCTCCT

CACCAACTCCTGTGTACCGGATACCGATTACTTCGAACCCCAGTACTTTGTACTCAGCCCAG - UNI23479 - GCCCAGAACCATGTCCTCATCAAC

TTCCTGGGAGCTGCCCCTGGTGGCTGTGTGCCAGGTAACATCAACACCAAACAAGCAAGAGAACTTTAAAACATGTGCTGAGTTGGTTCAAGAGGCTGCC

AGACTGGGTGCTTGCCTGGCCTTTCTGCCTGAGGCATTTGACTTTATTGCACGAAACCCTGCCGAGACATTACTCCTGTCCGAACCACTGAATGGGGATC

TTTTGGGCCAATATAGCCAGCTTGCCAG GGAATGTGGAATCTGGCTGTCCTTGGGCGGTTTCCACGAGCGTGGCCAAGACTGGGAGCAGAATCAGAAAA

TCTACAATTGTCATGTGCTTTTGAACAGCAAGG GATCAGTAGTGGCCAGTTACAGGAAGACACATCTGTGCGATGTAGAGATCCCAGGTCAGGGGCCGA

TGAGAGAAAGCAACTATACCAAGCCTGGAGGCACTCTTGAGCCACCTGTCAAGACACCGGCTGGCAAG GTTGGTCTAGCAATCTGTTATGACATGCGGT

TCCCTGAACTTTCTTTGAAATTGGCTCAAGCTGGGGCAGAAATACTTACTTATCCTTCAGCCTTTGGATCTGTTACAGGTCCAGCCCACTGGGAG CTCG

TCTCTTCTTGAGAGTAACGTAGGGCAGCAAGTCATGGCGAGTGATGATGCGCAGCAGCTGCAGCACCTGGCGAAAGTTACTCTCGTCACAGCGGCCCTGG

CGCTCCAGTGCCAATAAGAAGTCACGTCCATTTCGGATGAGTCCACGTTCATGGTCATCAATAACATCAACAAAAAGGAAGGAAAGCACTCGGACATCTC

TGTGTGTTAGGTGGGTGCCCACGATGTCGAACATGCGGTGGAGGCTGTAGAGCCCATGTTCTTGCTCCCCACGCTCTTCGGGCCACACCTGGCTTGCCCG

CCTCTTTAGGCCCGCCATGCTAGAGGCTCAGAAATAGAGTGCTTTCCAGAATCTCTGCTCAGCAGCTGCAATCTCCAGTGATCTGTAAGATAAGACAAGA

CCCCATGAGCCATGGGGCCACTGGTAGCCACCAATTTTATTTATCTTTATTATCTTAACGTGCTACTAATGAAGCTCAGCTTAATATGTTTATTAAATAT

CATAAAGTGTTTATGCTAGGTGTGGTGGCATACGCCTTTCATCTCAGCACTCAGGAGGCAGGGGCAAGTAGATCAGAGTGGCAGAACACTCAGGGCTACA

GAGACCCTGTCTCAAAAAAGCAAAAA
Translation
M - UNI23479 - MLGFITRPPHQLLCTGYRLLRTPVLCTQPR - UNI23479 - RPRTMSSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEA

ARLGACLAFLPEAFDFIARNPAETLLLSEPLNGDLLGQYSQLAR RECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKG GSVVASYRKTHLCDVEIP

GQGPMRESNYTKPGGTLEPPVKTPAGK VGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWE LVSS
Transcript ENSMUST00000111295
Sequence
GCCCACTTGCTCCTGCGCTCCTGGCTCCTGGCAGCTCTTGAGATCCGACCCCGTGAATGGTTTTGGCTGTGTCTTCAT - UNI23479 - GCTGGGCT

TCATCACCAGGCCTCCTCACCAACTCCTGTGTACCGGATACCGATTACTTCGAACCCCAGTACTTTGTACTCAGCCCAG - UNI23479 - GCCCAGA

ACCATGTCCTCATCAACTTCCTGGGAGCTGCCCCTGGTGGCTGTGTGCCAGGTAACATCAACACCAAACAAGCAAGAGAACTTTAAAACATGTGCTGAGT

TGGTTCAAGAGGCTGCCAGACTGGGTGCTTGCCTGGCCTTTCTGCCTGAGGCATTTGACTTTATTGCACGAAACCCTGCCGAGACATTACTCCTGTCCGA

ACCACTGAATGGGGATCTTTTGGGCCAATATAGCCAGCTTGCCAG GGAATGTGGAATCTGGCTGTCCTTGGGCGGTTTCCACGAGCGTGGCCAAGACTG

GGAGCAGAATCAGAAAATCTACAATTGTCATGTGCTTTTGAACAGCAAGG GATCAGTAGTGGCCAGTTACAGGAAGACACATCTGTGCGATGTAGAGAT

CCCAGGTCAGGGGCCGATGAGAGAAAGCAACTATACCAAGCCTGGAGGCACTCTTGAGCCACCTGTCAAGACACCGGCTGGCAAG GTTGGTCTAGCAAT

CTGTTATGACATGCGGTTCCCTGAACTTTCTTTGAAATTGGCTCAAGCTGGGGCAGAAATACTTACTTATCCTTCAGCCTTTGGATCTGTTACAGGTCCA

GCCCACTGGGAG GTGCTGCTGCGGGCCCGCGCCATTGAATCTCAGTGCTATGTAATAGCAGCAGCGCAGTGTGGACGCCACCATGAAACAAGAGCAAGT

TATGGCCATAGCATGGTGGTTGACCCGTGGGGCACAGTGGTGGCCCGCTGCTCCGAGGGACCAGGCCTCTGCCTTGCTCGAATTGATCTCCACTTTCTAC

AACAGATGCGCCAACACCTGCCTGTGTTCCAGCACCGCAGACCTGACCTCTATGGCAGTCTGGGTCATCCACTCTCTTAATGCTTTTAACTTCTGTTGGT

TAAGACACAGACACAGCCAACTGGGAGGTGATGCTACTGTGACTTGTAGGCAGGACACAAGCACGGTTCCCTTCACTTGCAGAACTTTAACCTCTCTTAA

TGGAACACAGGCTTAATCAAGTCCATGGGAAAGAAGAGACTTTGACCTGACCTCAGATTTCAGTTTCAGAAAAGTGGGATTTTATATAGTCACTGTTTAT

TTCATGAAAACTGAAGTTATGCTGAGGGCTGAGCAGCACTGGCATTGAAAAAAAAATATAATAATCA
Translation
M - UNI23479 - MLGFITRPPHQLLCTGYRLLRTPVLCTQPR - UNI23479 - RPRTMSSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEA

ARLGACLAFLPEAFDFIARNPAETLLLSEPLNGDLLGQYSQLAR RECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKG GSVVASYRKTHLCDVEIP

GQGPMRESNYTKPGGTLEPPVKTPAGK VGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWE VLLRARAIESQCYVIAAAQCGRHHETRAS

YGHSMVVDPWGTVVARCSEGPGLCLARIDLHFLQQMRQHLPVFQHRRPDLYGSLGHPLS
Transcript ENSMUST00000014141
Sequence
GAGATCCGACCCCGTGAATGGTTTTGGCTGTGTCTTCATGTAGGACCTACTCCCAAACCCTGCCCGCTGCG - UNI23479 - GCTGGGCTTCATCAC

CAGGCCTCCTCACCAACTCCTGTGTACCGGATACCGATTACTTCGAACCCCAGTACTTTGTACTCAGCCCAG - UNI23479 - GCCCAGAACCATGT

CCTCATCAACTTCCTGGGAGCTGCCCCTGGTGGCTGTGTGCCAGGTAACATCAACACCAAACAAGCAAGAGAACTTTAAAACATGTGCTGAGTTGGTTCA

AGAGGCTGCCAGACTGGGTGCTTGCCTGGCCTTTCTGCCTGAGGCATTTGACTTTATTGCACGAAACCCTGCCGAGACATTACTCCTGTCCGAACCACTG

AATGGGGATCTTTTGGGCCAATATAGCCAGCTTGCCAG GGAATGTGGAATCTGGCTGTCCTTGGGCGGTTTCCACGAGCGTGGCCAAGACTGGGAGCAG

AATCAGAAAATCTACAATTGTCATGTGCTTTTGAACAGCAAGG GATCAGTAGTGGCCAGTTACAGGAAGACACATCTGTGCGATGTAGAGATCCCAGGT

CAGGGGCCGATGAGAGAAAGCAACTATACCAAGCCTGGAGGCACTCTTGAGCCACCTGTCAAGACACCGGCTGGCAAG GTTGGTCTAGCAATCTGTTAT

GACATGCGGTTCCCTGAACTTTCTTTGAAATTGGCTCAAGCTGGGGCAGAAATACTTACTTATCCTTCAGCCTTTGGATCTGTTACAGGTCCAGCCCACT

GGGAG GTGCTGCTGCGGGCCCGCGCCATTGAATCTCAGTGCTATGTAATAGCAGCAGCGCAGTGTGGACGCCACCATGAAACAAGAGCAAGTTATGGCC

ATAGCATGGTGGTTGACCCGTGGGGCACAGTGGTGGCCCGCTGCTCCGAGGGACCAGGCCTCTGCCTTGCTCGAATTGATCTCCACTTTCTACAACAGAT

GCGCCAACACCTGCCTGTGTTCCAGCACCGCAGACCTGACCTCTATGGCAGTCTGGGTCATCCACTCTCTTAATGCTTTTAACTTCTGTTGGTTAAGACA

CAGACACAGCCAACTGGGAGGTGATGCTACTGTGACTTGTAGGCAGGACACAAGCACGGTTCCCTTCACTTGCAGAACTTTAACCTCTCTTAATGGAACA

CAGGCTTAATCAAGTCCATGGGAAAGAAGAGACTTTGACCTGACCTCAGATTTCAGTTTCAGAAAAGTGGGATTTTATATAGTCACTGTTTATTTCATGA

AAACTGAAGTTATGCTGAGGGCTGAGCAGCACTGGCATTGAAAAAAAAATATAATAATCATAATGTCTGGACATGTCTTTTGGGGGCTAGAAGGGGAGGT

GGAATTGTACCTGCTTGACTGGACTTCACTCCTCAGCCTCCTGCCTCAAACATGCCTCCTTACCTAAGAAAGTGCGGTGCTCAGTGCATGTACTAGTCCT

GCTCTCCAAAGGATGGGAGAAGGGAGGGCAGAGGAACAGGAGGAGCTGATACTAAATACCCCACTTTCTCTCAAGCAAGAAGGAAGCAAAGGGAAAGGGC

CTTGGGGTGGGGTAAGAGTTATTTTCACTGGAAAAGGGAAGGAAAATGTCATACCCCCCACCCCCTCCTCCTCTTCAGAGAAAGTGTGCTCCAACTAGCA

GCCTCTACTCCACTGTCCTGTGTACTGGTGTTCACATACACATCGCAGTTGGGAGGGTGATCGATCAGGCTGGCCCAGTCCTCTGTAAGTTTGCTGAACA

TTTGACAGGGACAAGGAGGGATCCATACGACAGCAGTTCCCGCTGTGGAATGAAGGAAAGGCAGAGAGGAGCAGCACCAAGGCCAGGAGAGACTGCAAAG

GGCCACAGCTTCTCTGTTTTTAAAAAATTCTATAATTTGGAAGAAGGTGGTAATTAATTTCCAAAATACACTTCAGAGTCCCACCTTCCACATAGCTCCT

TTACTCACAGCCCTTTGGTTTTTCAGACAAAATTTAAGAGCCCTCATAAAGCCATAAGTATTGATTACCCCTCAATGCACCTGAAAGCAGTGTTCAATCC

CTTACAAAGGCTGTGTTCCAGAGACCCTGTCCCTATACACTTGTCTTACGGCTCAGTGGTAAGGTGGCTGTAGACACACAATAGGGTAAGTGGCAACAGG

AAACGGGGAAGCCCAGGCACATGGGTGCAGGGAGGGCAGGGACACCACTTCCACCTTCCTTTGTCTTTTCCTTTTAAAAAAAAAAAAAAAAAAAGGCGGT

GTGATTGGTTGGAAAGGGTAGAGAACAAACCCCAGAACAGTATGTCAGCTCCAGAGGTGACGGAGCGAACAGTCCCCAGAAAGGTGAGAAGGGGAAAGGT

CAGGGTAATGCCTGCAGCATCAAGTTCCTCAGGAGTTTCTGTCGGCCCAGCTCATAGTCCTCCTCATCCACGTTCACCAGCAGCTTGATGGCTTCATGGC

CCACAGCTTGCTTGAGAGAGTCTGTGATGAAGACACCTTTCAGTGCCTCTAATAATGAGCCATTAATGTAGTCTCGCCAGAATGCGTCGAGGTAGGTGAG

CTCAGAGAACTTGATGTCACAGATGATGGAGCCCAGGTCCCGGGACTTGAGGATAGTGTTGGCCTGGTTAAAGCGCTCAAACTGGCGCTCAAGTGGGTCC

TGCTTATTGGAGAAGACATTGCCTTGCAGAGCCGTCTCATGCTGGCAGTATTCCGCCCGAACTCGGAGCCTGATATCTGGGAGAATTTTAAGGAGCATGG

TTTATAATGGATTGTGTTTACAACCAAAGCTAGAAAAGCAAGCAAGCAAGGCTGAGACCCTCCCTCTTCTCACAGCTTCTTTACCTCTCCCCAGAACTAG

TTCTTCACTGTGTCACTGGTTTCAATTCTGGAGCTGCCCTACAATGCCCTACAATGACTCTGCTCAGGCCACTCACAAACAGCACCTTGTTAGAAGACCT

GTCTTATTAAAAAGTTGCACAAATTT
Translation
 - UNI23479 - LGFITRPPHQLLCTGYRLLRTPVLCTQPR - UNI23479 - RPRTMSSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEAAR

LGACLAFLPEAFDFIARNPAETLLLSEPLNGDLLGQYSQLAR RECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKG GSVVASYRKTHLCDVEIPGQ

GPMRESNYTKPGGTLEPPVKTPAGK VGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWE VLLRARAIESQCYVIAAAQCGRHHETRASYG

HSMVVDPWGTVVARCSEGPGLCLARIDLHFLQQMRQHLPVFQHRRPDLYGSLGHPLS
Transcript ENSMUST00000111289
Sequence
CGCCCACTTGCTCCTGCGCTCCTGGCTCCTGGCAGCTCTTGAGATCCGACCCCGTGAATGGTTTTGGCTGTGTCTTCATGTAGGACCTACTCCCAAACCC

TGCCCGCTGCG - UNI23479 - GCTGGGCTTCATCACCAGGCCTCCTCACCAACTCCTGTGTACCGGATACCGATTACTTCGAACCCCAGTACTTTG

TACTCAGCCCAG - UNI23479 - GCCCAGAACCATGTCCTCATCAACTTCCTGGGAGCTGCCCCTGGTGGCTGTGTGCCAGGTAACATCAACACCAA

ACAAGCAAGAGAACTTTAAAACATGTGCTGAGTTGGTTCAAGAGGCTGCCAGACTGGGTGCTTGCCTGGCCTTTCTGCCTGAGGCATTTGACTTTATTGC

ACGAAACCCTGCCGAGACATTACTCCTGTCCGAACCACTGAATGGGGATCTTTTGGGCCAATATAGCCAGCTTGCCAG GGAATGTGGAATCTGGCTGTC

CTTGGGCGGTTTCCACGAGCGTGGCCAAGACTGGGAGCAGAATCAGAAAATCTACAATTGTCATGTGCTTTTGAACAGCAAGG GATCAGTAGTGGCCAG

TTACAGGAAGACACATCTGTGCGATGTAGAGATCCCAGGTCAGGGGCCGATGAGAGAAAGCAACTATACCAAGCCTGGAGGCACTCTTGAGCCACCTGTC

AAGACACCGGCTGGCAAG GTTGGTCTAGCAATCTGTTATGACATGCGGTTCCCTGAACTTTCTTTGAAATTGGCTCAAGCTGGGGCAGAAATACTTACT

TATCCTTCAGCCTTTGGATCTGTTACAGGTCCAGCCCACTGGGAG GTGCTGCTGCGGGCCCGCGCCATTGAATCTCAGTGCTATGTAATAGCAGCAGCG

CAGTGTGGACGCCACCATGAAACAAGAGCAAGTTATGGCCATAGCATGGTGGTTGACCCGTGGGGCACAGTGGTGGCCCGCTGCTCCGAGGGACCAGGCC

TCTGCCTTGCTCGAATTGATCTCCACTTTCTACAACAGATGCGCCAACACCTGCCTGTGTTCCAGCACCGCAGACCTGACCTCTATGGCAGTCTGGGTCA

TCCACTCTCTTAATGCTTTTAACTTCTGTTGGTTAAGACACAGACACAGCCAACTGGGAGGTGATGCTACTGTGACTTGTAGGCAGGACACAAGCACGGT

TCCCTTCACTTGCAGAACTTTAACCTCTCTTAATGGAACACAGGCTTAATCAAGTCCATGGGAAAGAAGAGACTTTGACCTGACCTCAGATTTCAGTTTC

AGAAAAGTGGGATTTTATATAGTCACTGTTTATTTCATGAAAACTGAAGTTATGCTGAGGGCTGAGCAGCACTGGCATTGAAAAAAAAATATAATAATCA

TAATGTCTGGACATGTCTTTTGGGGGCTAGAAGGGGAGGTGGAATTGTACCTGCTTGACTGGACTTCACTCCTCAGCCTCCTGCCTCAAACATGCCTCCT

TACCTAAGAAAGTGCGGTGCTCAGTGCATGTACTAGTCCTGCTCTCCAAAGGATGGGAGAAGGGAGGGCAGAGGAACAGGAGGAGCTGATACTAAATACC

CCACTTTCTCTCAAGCAAGAAGGAAGCAAAGGGAAAGGGCCTTGGGGTGGGGTAAGAGTTATTTTCACTGGAAAAGGGAAGGAAAATGTCATACCCCCCA

CCCCCTCCTCCTCTTCAGAGAAAGTGTGCTCCAACTAGCAGCCTCTACTCCACTGTCCTGTGTACTGGTGTTCACATACACATCGCAGTTGGGAGGGTGA

TCGATCAGGCTGGCCCAGTCCTCTGTAAGTTTGCTGAACATTTGACAGGGACAAGGAGGGATCCATACGACAGCAGTTCCCGCTGTGGAATGAAGGAAAG

GCAGAGAGGAGCAGCACCAAGGCCAGGAGAGACTGCAAAGGGCCACAGCTTCTCTGTTTTTAAAAAATTCTATAATTTGGAAGAAGGTGGTAATTAATTT

CCAAAATACACTTCAGAGTCCCACCTTCCACATAGCTCCTTTACTCACAGCCCTTTGGTTTTTCAGACAAAATTTAAGAGCCCTCATAAAGCCATAAGTA

TTGATTACCCCTCAATGCACCTGAAAGCAGTGTTCAATCCCTTACAAAGGCTGTGTTCCAGAGACCCTGTCCCTATACACTTGTCTTACGGCTCAGTGGT

AAGGTGGCTGTAGACACACAATAGGGTAAGTGGCAACAGGAAACGGGGAAGCCCAGGCACATGGGTGCAGGGAGGGCAGGGACACCACTTCCACCTTCCT

TTGTCTTTTCCTTTTAAAAAAAAAAAAAAAAAAAGGCGGTGTGATTGGTTGGAAAGGGTAGAGAACAAACCCCAGAACAGTATGTCAGCTCCAGAGGTGA

CGGAGCGAACAGTCCCCAGAAAGGTGAGAAGGGGAAAGGTCAGGGTAATGCCTGCAGCATCAAGTTCCTCAGGAGTTTCTGTCGGCCCAGCTCATAGTCC

TCCTCATCCACGTTCACCAGCAGCTTGATGGCTTCATGGCCCACAGCTTGCTTGAGAGAGTCTGTGATGAAGACACCTTTCAGTGCCTCTAATAATGAGC

CATTAATGTAGTCTCGCCAGAATGCGTCGAGGTAGGTGAGCTCAGAGAACTTGATGTCACAGATGATGGAGCCCAGGTCCCGGGACTTGAGGATAGTGTT

GGCCTGGTTAAAGCGCTCAAACTGGCGCTCAAGTGGGTCCTGCTTATTGGAGAAGACATTGCCTTGCAGAGCCGTCTCATGCTGGCAGTATTCCGCCCGA

ACTCGGAGCCTGATATCTGGGAGAATTTTAAGGAGCATGGTTTATAATGGATTGTGTTTACAACCAAAGCTAGAAAAGCAAGCAAGCAAGGCTGAGACCC

TCCCTCTTCTCACAGCTTCTTTACCTCTCCCCAGAACTAGTTCTTCACTGTGTCACTGGTTTCAATTCTGGAGCTGCCCTACAATGCCCTACAATGACTC

TGCTCAGGCCACTCACAAACAGCACCTTGTTAGAAGACCTGTCTTATTAAAAAGTTGCACAAATTTACTTTAA
Translation
 - UNI23479 -  - UNI23479 - MSSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEAARLGACLAFLPEAFDFIARNPAETLLLSEPLNGDL

LGQYSQLAR RECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKG GSVVASYRKTHLCDVEIPGQGPMRESNYTKPGGTLEPPVKTPAGK VGLAICY

DMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWE VLLRARAIESQCYVIAAAQCGRHHETRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLHFLQQ

MRQHLPVFQHRRPDLYGSLGHPLS

For any suggestions or comments, please send an email to unitrap@crg.es