Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014243 (2410012H22Rik)
Chromosomal location
Chr 11: 62080732 - 62094877 (-)
Description
zinc finger, SWIM-type containing 7 Gene [Source:MGI Symbol;Acc:MGI:1916997]
UniGene
Mm.141150 
MGI
MGI:1916997 
Uniprot/SWISSPROT
Q9CWQ2 
Human Ortholog
ENSG00000214941 (ZSWIM7)
Omim not available
UniTrap UNI3041
Vector Insertion
Chr 11: 62090119 - 62094878
Public Clones DC0628 (sanger) IST10891E7 (tigm) IST12774B12 (tigm)
Private Clones OST373852 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI861
Vector Insertion
Chr 11: 62082311 - 62087213
Public Clones CB0251 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072916
Sequence
GAAGTTCGCAGCGCCCGGGAGGAGAGAAGACGGGCGGCGTGCCATGGCGGTCGCGCTCCCGGAGGTGGTGGAAGAGCTCCTGAGCGAGATGGCCGCCGCT

GTGCGAGACAGCGCGAGAA - UNI3041 - TTCCCGACGAGCTTCTCTTATC - UNI3041 - GCTGGAGTTTGTGTTTGGGTCATCGGCCATCCA

GGCCTTGGACCTAGTCGATCGAGAGTCCGTCACTTTAATCTCATCACCCAGTGGAAGGCGTGTTTACCAG - UNI861 - GTGCTAGGGAGTTCTGGC

AAAACATATACATGTCTGGCTTCCTGTCATTACTGCTCGTGCCCAGCATTCTCCTTCTCAGTGTTACGGAAGAGTGACAGCCTGCTG TGTAAGCATCTT

CTGGCAATTTACCTTAGTCAGCTTCTGAGGAACTGCCAGCAGCTCCATGTGTCTGACAAGCAACTGACAGACCTATTGATGGAGGACACAAGAAGGATAA

AAGGTGCGGCTGGAACATGGACTTCAAAGACAGAAGCCTAGCAGGAAACGCATTCACATCTCACGGTGCCCGAGGTGGAGGAATGGGATGCACTTCCAGA

CTTGTGACTGTCACTTCACCCTCACAGGCTAGGCTGCAGAGGGTCTGTGTGGTTAAGAGCCCTCTATGGTCTTAATATTAGCCAGCCTCTGAGCCCTGCA

GGTAGAAATGTCCCTTGGGAGAATTAAGTATTGTTGACTCAAATAAAGCCTGAGCCATGTTGTAT
Translation
MAVALPEVVEELLSEMAAAVRDSARI - UNI3041 - IPDELLLS - UNI3041 - SLEFVFGSSAIQALDLVDRESVTLISSPSGRRVYQ - UN

I861 - VLGSSGKTYTCLASCHYCSCPAFSFSVLRKSDSLL CKHLLAIYLSQLLRNCQQLHVSDKQLTDLLMEDTRRIKGAAGTWTSKTEA

For any suggestions or comments, please send an email to unitrap@crg.es