Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014353 (Tmem87b)
Chromosomal location
Chr 2: 128643854 - 128679997 (+)
Description
transmembrane protein 87B Gene [Source:MGI (curated);Acc:Tmem87b-001]
RefSeq_dna
NM_028248 
RefSeq_peptide
NP_082524.2 
UniGene
Mm.259688 
MGI
MGI:1919727 
Uniprot/SWISSPROT
Q8BKU8 
Human Ortholog
ENSG00000153214 (TMEM87B)
Omim not available
UniTrap UNI23459
Vector Insertion
Chr 2: 128648880 - 128650151
Public Clones not available
Private Clones OST258584 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1793
Vector Insertion
Chr 2: 128652125 - 128654141
Public Clones CC0404 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8825
Vector Insertion
Chr 2: 128656996 - 128657185
Public Clones XST168 (baygenomics) TEA130 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3235
Vector Insertion
Chr 2: 128663132 - 128664883
Public Clones AL0595 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI419
Vector Insertion
Chr 2: 128667220 - 128668331
Public Clones BC0610 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110325
Sequence
ACTTCCTCGGTTCCTTCCAGGCCTGGCCCTGAAGCCCTGCTCCAGGTTTGAGCCTATTTCCTCTAACAGCGCCTATCCGCTTCAGCCCAAGACCCCCTCC

GCATTCACGCCCGTGCTCTCGTTCCCCTCGTGGGCACGCCCCTTCAGGGGCGGAGCTGAGCCAGGTGCGGCCCCGGGGCGTGGCCGGGTTCCGGGAGCGC

AGGTGCGGCGTCCGCGTCAAGATGGCTGCCGCCTGTCGGTCTGAGGCTGGCCTCCTTCCCAGCCTCCTCTGCCGCCGGCCCGCCGGGGCCCAGCTGCTGC

GAGTTGCCCTGTGTCTCCTGTGCTGGGTCCCGGCGGCTGTGGACGCAGTCCCCGAGCTCGGGCTTTGGACGAGGACGGTCAATGAC AAATCAGGACCTT

TGGTATTCAGGAAAACTATGTTTAACTCTACTGAGATCAAGTTTTCTG - UNI23459 - TGAAGTCGTTCAGTTGTTCTGGACCTGTGAAGTTTACC

ATAGAGTGGCATTTGAAGTATCATACCTGTCACAATGATTACCCTGATCTGGAGGAG GAGCTGTCCCAAAGACATGAACTTCATGCTGATCCAGATGTC

TGTGCTTACTTCAAAAACATTGACTGTTGGACAACAAAAAGTGAAAACTTGGATTGCAGCAGTGATTCACAGGCATTTCCCTCATTGAAT - UNI1793

 - AATAAAGAACTAACAGGTATCAGAAACATTTCAAGCCAGGAAGGATCAACG GATGTTGTAGCCAGGACCCAGAAAGATGGCTTCCATATCTTCATT

GTTTCTATTAAAACGGAGAAAACAGATGCAGTCTGGGATTTAAATG TTTCTCTTTCTATGGTGGGTCCTCATGGGTACATCTCTGCATCAGACTGGCCT

CTCATGATT - UNI8825 - TTTTATATGGTGATGTGTATCGTTTACATATTATATGGTGTCCTCTGGCTGCTGTGGTCTGCCTGTTACTGGAAAGAT

ATATTAAGAATTCAGTTCTGGATTGCAGCTGTTATTTTCCTAGGAATGCTTGAAAAGGCAGTTTTTTATAGTGAATACCAAAACATCAACAGCACTGGAC

TGTCAA CTCAAGGTTTACTGATATTTGCAGAGCTGATATCTGCAGTTAAGAGGACATTGGCTCGCCTGCTTGTGATCATTGTGAGCTTGGGTTATGGCA

TTGTGAA GCCTCGCTTAGGAACAGTGATGCACCGGGTGATTGGACTGGGACTGCTTTACTTGATCTTTGCAGCCATTGAAGGCGTCATGAGAGTCATCG

GG - UNI3235 - GGTTCTAAACATTTAGCTGTTGTTTTGACTGACATTGTTTTAGCAGTTATTGACTCCATTTTTGTGTGGTTC ATTTTTATAAGT

TTGGCACAGACTATGAAGACTCTAAGGCTAAGAAAGAACACAGTGAAATTTTCATTGTATAGGCATTTTACAAATACACTCATCTTTGCAGTGCTGG CT

TCTATAGTGTTTATGGTGTGGACAACAAAGACCTTCAGGATCGCAAAATGCCAATCA - UNI419 - GACTGGATGGAGCTGTGGGTTGACGATGCGT

TTTGGAGCTTCCTCTTTTCAGTCATCCTTATTGTGATAATGTTCTTATGGAGGCCGTCAGCAAATAATCAGAG GTATGCCTTCATGCCCTTGATAGATG

ACTCTGATGATGAAGTCGAGGAATTCATGGTAACATCTGAAAATTTAA CTGAGGGAATAAAACTAAGAGCCTCAAAAACGGTTTCAAACGGAACAGCTA

AACCTACGTCTGATAATTTT GATGAAGATTTGAAGTGGGTGGAAGAAAACATTCCCTCTTCGTTCACAGATGT AGCTCTCCCAGTGTTAGTGGACTCA

GATGAG GAAATTATGACCAGATCTGAAATAGCTGAAAAAATGTTCTCTTCAGAAAAGATAATGTGATCAGGGCCCCAGTGGGTCCGGTGTGTGCAGGAG

CACAGTCAGGTGATGGGAAAAGCCTGGCTCTCATCAAAACTGACAGCTTCACTATGATACGTGTTTCCCTTTGTTGTCTTGGAGATCTGTGTATGCAGAT

GAAGAATTCAGGAGTGGGAGGGTCTGCCACCCTCAGAAAGCCATCTTTAAAACTAACTTAGACAGTCAGTTTCATGGCCATTAAGTTGCCTGATTTGGAA

ACAATTTAAGAAGTTAACAACATGTGCTCAGATGCCTCTTAGGCGGCAGCCACAGGCATGCCATGTTGTGTGTCTCAGTTTTCTCTGGACAAACGAATCT

GTAGCTGGGCTGGCGGCACACTACTGGTAAATTCAAAACCACGCCTGGTCTACATAGTTCTGGGACAACCAGAGAGAGCTACATAGTGAGACCCTGCCTC

AAAAAAAACAAAAACCAAAAAGGAAAAGGAAAGAGAAGAATCTATGAGCATTCCTTCCCTCGCCTTCGAGATAACGTGATTCTCCTGAATGCTAACACAG

CACTGTTCATCTTTTGTAATGATAATTTTATTTGATTTTTTTATACTGAAGTGACAATATTGGAACTCGAGCATGTTCATATATTTAATCTTGTCCCTTT

CATTGGTGTACACAAAGCTCTTGTTTGTAAATACCACCATGCACTACACATCACGGAGTCTGAGCTCGGGAACACGTATGGGCAAAGAGAGACGTCTTGA

GGGTATGTCCAAAGACTTGCAGGCCACAGGTACACGTGCTGCTGCTACTTCTGCTGTGAACCTGGCCATGTGACTCCCCTACAGCACTTTATCTCAGCCC

CGGTGCACTGTTTCTTGTGAGCCTTGTGGAGACTTGTGAGATATACAAACATCTAACCTTACCATGCATCAACATGTACTTAACCAGCTCTCAACCATAT

CTTACACCTTGTTGTTAAATTATGTTTATAATGTATGATTGAAAGTTTCTATTCTAATATTTTTTGAATATAGAATGTTCTAGACTTGAAAGGCACTTGA

ATGTAGAGTGATGAAAATGTGAACGTTTTGCCACGTTCGTGACCAAAGATACCAGGCTGTTGGACATGTAATGTGGTAATGACAGGCAGGGTCTTGTATG

CCTTCTCTGGAGGACTTCTGCCCTGTGAGTTAGAATAACTTGGGATAATTGAGAAAACATGAAAATGACAAGGAAGAGCACTATCCATAGCCTATGATGA

TTTTTTCACTGTGGCACCACAAAACAAAAGGTTTTCTTTCAAATGCCTACTTTCTGAGTTTATTTCCTGCGTACTCGTTTCAAAAGGGTTGGTAGTGACA

TATTTCTATAGTTGCGTGTCCGTTTTAGGTTTGTCATAGTCCACCTTGTAACCCAGCTCTGTGAAAACTGGGGATGTCTTGCACGGGGAGGAGCATTGCA

GGGTGTCACTGTATAGCTCTGGCTGAGGATGGGCTTGCGAACCTCTTGCTAAGACTCTAGGCATGCACTACCATGGCCTGCTTCACGTTTTTAGTACCCT

GTCCTCACAGCATGAAGTAGCTGACTCTCAACCCACAGGTCTGCACTTGAGTATTTCTGCTTAGAGCCAGCAGGAGCTACACATTGAGCAGGGTGAGTCT

GCAGTTGATGGCTGGGGAAATGCTTCTGACACCACCTCAATGGGATTTCTAAAAAGCAGGGAAGACAAATGATGCTGCCTCTGGTGTAGCTCCAGACTGA

AATGACTCTCTGTCCAGAGAAAGTGGACTTCCATCTTAACCTCCTTACAAGTGTTTTTGCAAGCATGTGTGTGGTGTCTGTTGCATTTACTGATAACTGC

CAGGTGCTAATGTTCAGTGCCCTAAAGTGAGTGTTTCTCGGGGCCCTTCTTAGCCCCAGCATGTGTCCCTGTGCTGCCACTGTAGCTGACAAGGACGGGA

GGTGCACCCAGGACCTCCGTGCAGCTCCTCAGGCTCCTTCCCCGTCTGCCCCAAGTCTGCAGACCACACTGGGACCTCACAGGTGCTCAGCTCAGCCTCC

GTTCAGGATGCTGCTGTAGGATGGCTCTGGTAATTGAGAACACTAAGGATCAGGCTCCAGTTGTATTCAAGACTTCTTGTTATACAGTTCATGTTAGATT

TGGAGGCATATGAAGTTTGCTTGAGACATTTTTTTCGTGCTTTGAATTAGGTTAATATTTAAAAATCTGCCTTTGGGGGTATTTATTACATTTCAGTAAG

AAACAGGAGGTGGAAATTGTAAGCTTGGGAGTTGGTAGGATACTCCCATGCATTTCCTGTTTTTTGTTTGTTTGTTTGCTTTTTTGGGTTTTGTTTTTAA

TCTGTCCTGTGCAGAGTGCCACCTGTATCACGGTACATCATGTTTATACTACTATGTCAAGATTAAGCTTAAAGTATACATACAGAGTTGATTTTTATAC

CCTCTTGAAGGTTTGGAGCTATTGCCCTGGCTGTATATGACTGAAGCTGAGAGAGATCATGCTACGTTTTGTCTCTCGTTCTGATATTTGTGTCTTTGTA

TGGTTGACAGCATGCAGTAAGCAATATAAAACACCAAGCCTTACGTCTATCAGAAAGAAGTTTAATATATAAAATTCTGAACATATAAATATATTTAAGT

GACAATACTAGAGTTTTAAGGAAGTGTGTACTCCAGGACGGGGACTCCAGGGCGGGGACTCAATACTGTACTTAGAAGCTTCTTCAGAATTAGGGAAACA

TTCATTTCCTTGGGGAGAAAGTTTAGAGGTTAAAAATAGATTCTCTATTTTAAAAAGTTAAATTATAATTTGGAAGAAATTTCTTTGACTATAGAACACA

GCAATTTAAAGGAATTTTGTTTGAAATTTTGTATTTTTGTGCCTTAATATTTGGTTTTTTAATAAATTGCTTTCTGACATTTGGA
Translation
MAAACRSEAGLLPSLLCRRPAGAQLLRVALCLLCWVPAAVDAVPELGLWTRTVND KSGPLVFRKTMFNSTEIKFSV - UNI23459 - VKSFSCSGP

VKFTIEWHLKYHTCHNDYPDLEE ELSQRHELHADPDVCAYFKNIDCWTTKSENLDCSSDSQAFPSLN - UNI1793 - NKELTGIRNISSQEGST D

VVARTQKDGFHIFIVSIKTEKTDAVWDLNV VSLSMVGPHGYISASDWPLMI - UNI8825 - FYMVMCIVYILYGVLWLLWSACYWKDILRIQFWIA

AVIFLGMLEKAVFYSEYQNINSTGLST TQGLLIFAELISAVKRTLARLLVIIVSLGYGIVK KPRLGTVMHRVIGLGLLYLIFAAIEGVMRVIG - UN

I3235 - GSKHLAVVLTDIVLAVIDSIFVWF IFISLAQTMKTLRLRKNTVKFSLYRHFTNTLIFAVLA ASIVFMVWTTKTFRIAKCQS - UNI419

 - DWMELWVDDAFWSFLFSVILIVIMFLWRPSANNQR RYAFMPLIDDSDDEVEEFMVTSENLT TEGIKLRASKTVSNGTAKPTSDNF DEDLKWVEE

NIPSSFTDV VALPVLVDSDE EIMTRSEIAEKMFSSEKIM
Transcript ENSMUST00000014498
Sequence
GGGTTCCGGGAGCGCAGGTGCGGCGTCCGCGTCAAGATGGCTGCCGCCTGTCGGTCTGAGGCTGGCCTCCTTCCCAGCCTCCTCTGCCGCCGGCCCGCCG

GGGCCCAGCTGCTGCGAGTTGCCCTGTGTCTCCTGTGCTGGGTCCCGGCGGCTGTGGACGCAGTCCCCGAGCTCGGGCTTTGGACGAGGACGGTCAATGA

C AAATCAGGACCTTTGGTATTCAGGAAAACTATGTTTAACTCTACTGAGATCAAGTTTTCTG - UNI23459 - TGAAGTCGTTCAGTTGTTCTGGA

CCTGTGAAGTTTACCATAGAGTGGCATTTGAAGTATCATACCTGTCACAATGATTACCCTGATCTGGAGGAG GAGCTGTCCCAAAGACATGAACTTCAT

GCTGATCCAGATGTCTGTGCTTACTTCAAAAACATTGACTGTTGGACAACAAAAAGTGAAAACTTGGATTGCAGCAGTGATTCACAGGCATTTCCCTCAT

TGAAT - UNI1793 - AATAAAGAACTAACAGGTATCAGAAACATTTCAAGCCAGGAAGGATCAACG GATGTTGTAGCCAGGACCCAGAAAGATGGC

TTCCATATCTTCATTGTTTCTATTAAAACGGAGAAAACAGATGCAGTCTGGGATTTAAATG TTTCTCTTTCTATGGTGGGTCCTCATGGGTACATCTCT

GCATCAGACTGGCCTCTCATGATT - UNI8825 - TTTTATATGGTGATGTGTATCGTTTACATATTATATGGTGTCCTCTGGCTGCTGTGGTCTGCC

TGTTACTGGAAAGATATATTAAGAATTCAGTTCTGGATTGCAGCTGTTATTTTCCTAGGAATGCTTGAAAAGGCAGTTTTTTATAGTGAATACCAAAACA

TCAACAGCACTGGACTGTCAA CTCAAGGTTTACTGATATTTGCAGAGCTGATATCTGCAGTTAAGAGGACATTGGCTCGCCTGCTTGTGATCATTGTGA

GCTTGGGTTATGGCATTGTGAA GCCTCGCTTAGGAACAGTGATGCACCGGGTGATTGGACTGGGACTGCTTTACTTGATCTTTGCAGCCATTGAAGGCG

TCATGAGAGTCATCGGG - UNI3235 - GGTTCTAAACATTTAGCTGTTGTTTTGACTGACATTGTTTTAGCAGTTATTGACTCCATTTTTGTGTGGT

TCATATCCTTTACCATGTCCTTCCAAAATAGTTGGTG TTTGGCACAGACTATGAAGACTCTAAGGCTAAGAAAGAACACAGTGAAATTTTCATTGTATA

GGCATTTTACAAATACACTCATCTTTGCAGTGCTGG CTTCTATAGTGTTTATGGTGTGGACAACAAAGACCTTCAGGATCGCAAAATGCCAATCA - U

NI419 - GACTGGATGGAGCTGTGGGTTGACGATGCGTTTTGGAGCTTCCTCTTTTCAGTCATCCTTATTGTGATAATGTTCTTATGGAGGCCGTCAGC

AAATAATCAGAG GTATGCCTTCATGCCCTTGATAGATGACTCTGATGATGAAGTCGAGGAATTCATGGTAACATCTGAAAATTTAA CTGAGGGAATAA

AACTAAGAGCCTCAAAAACGGTTTCAAACGGAACAGCTAAACCTACGTCTGATAATTTT GATGAAGATTTGAAGTGGGTGGAAGAAAACATTCCCTCTT

CGTTCACAGATGT AGCTCTCCCAGTGTTAGTGGACTCAGATGAG GAAATTATGACCAGATCTGAAATAGCTGAAAAAATGTTCTCTTCAGAAAAGATA

ATGTGATCAGGGCCCCAGTGGGTCCGGTGTGTGCAGGAGCACAGTCAGGTGATGGGAAAAGCCTGGCTCTCATCAAAACTGACAGCTTCACTATGATACG

TGTTTCCCTTTGTTGTCTTGGAGATCTGTGTATGCAGATGAAGAATTCAGGAGTGGGAGGGTCTGCCACCCTCAGAAAGCCATCTTTAAAACTAACTTAG

ACAGTCAGTTTCATGGCCATTAAGTTGCCTGATTTGGAAACAATTTAAGAAGTTAACAACATGTGCTCAGATGCCTCTTAGGCGGCAGCCACAGGCATGC

CATGTTGTGTGTCTCAGTTTTCTCTGGACAAACGAATCTGTAGCTGGGCTGGCGGCACACTACTGGTAAATTCAAAACCACGCCTGGTCTACATAGTTCT

GGGACAACCAGAGAGAGCTACATAGTGAGACCCTGCCTCAAAAAAAACAAAAACCAAAAAGGAAAAGGAAAGAGAAGAATCTATGAGCATTCCTTCCCTC

GCCTTCGAGATAACGTGATTCTCCTGAATGCTAACACAGCACTGTTCATCTTTTGTAATGATAATTTTATTTGATTTTTTTATACTGAAGTGACAATATT

GGAACTCGAGCATGTTCATATATTTAATCTTGTCCCTTTCATTGGTGTACACAAAGCTCTTGTTTGTAAATACCACCATGCACTACACATCACGGAGTCT

GAGCTCGGGAACACGTATGGGCAAAGAGAGACGTCTTGAGGGTATGTCCAAAGACTTGCAGGCCACAGGTACACGTGCTGCTGCTACTTCTGCTGTGAAC

CTGGCCATGTGACTCCCCTACAGCACTTTATCTCAGCCCCGGTGCACTGTTTCTTGTGAGCCTTGTGGAGACTTGTGAGATATACAAACATCTAACCTTA

CCATGCATCAACATGTACTTAACCAGCTCTCAACCATATCTTACACCTTGTTGTTAAATTATGTTTATAATGTATGATTGAAAGTTTCTATTCTAATATT

TTTTGAATATAGAATGTTCTAGACTTGAAAGGCACTTGAATGTAGAGTGATGAAAATGTGAACGTTTTGCCACGTTCGTGACCAAAGATACCAGGCTGTT

GGACATGTAATGTGGTAATGACAGGCAGGGTCTTGTATGCCTTCTCTGGAGGACTTCTGCCCTGTGAGTTAGAATAACTTGGGATAATTGAGAAAACATG

AAAATGACAAGGAAGAGCACTATCCATAGCCTATGATGATTTTTTCACTGTGGCACCACAAAACAAAAGGTTTTCTTTCAAATGCCTACTTTCTGAGTTT

ATTTCCTGCGTACTCGTTTCAAAAGGGTTGGTAGTGACATATTTCTATAGTTGCGTGTCCGTTTTAGGTTTGTCATAGTCCACCTTGTAACCCAGCTCTG

TGAAAACTGGGGATGTCTTGCACGGGGAGGAGCATTGCAGGGTGTCACTGTATAGCTCTGGCTGAGGATGGGCTTGCGAACCTCTTGCTAAGACTCTAGG

CATGCACTACCATGGCCTGCTTCACGTTTTTAGTACCCTGTCCTCACAGCATGAAGTAGCTGACTCTCAACCCACAGGTCTGCACTTGAGTATTTCTGCT

TAGAGCCAGCAGGAGCTACACATTGAGCAGGGTGAGTCTGCAGTTGATGGCTGGGGAAATGCTTCTGACACCACCTCAATGGGATTTCTAAAAAGCAGGG

AAGACAAATGATGCTGCCTCTGGTGTAGCTCCAGACTGAAATGACTCTCTGTCCAGAGAAAGTGGACTTCCATCTTAACCTCCTTACAAGTGTTTTTGCA

AGCATGTGTGTGGTGTCTGTTGCATTTACTGATAACTGCCAGGTGCTAATGTTCAGTGCCCTAAAGTGAGTGTTTCTCGGGGCCCTTCTTAGCCCCAGCA

TGTGTCCCTGTGCTGCCACTGTAGCTGACAAGGACGGGAGGTGCACCCAGGACCTCCGTGCAGCTCCTCAGGCTCCTTCCCCGTCTGCCCCAAGTCTGCA

GACCACACTGGGACCTCACAGGTGCTCAGCTCAGCCTCCGTTCAGGATGCTGCTGTAGGATGGCTCTGGTAATTGAGAACACTAAGGATCAGGCTCCAGT

TGTATTCAAGACTTCTTGTTATACAGTTCATGTTAGATTTGGAGGCATATGAAGTTTGCTTGAGACATTTTTTTCGTGCTTTGAATTAGGTTAATATTTA

AAAATCTGCCTTTGGGGGTATTTATTACATTTCAGTAAGAAACAGGAGGTGGAAATTGTAAGCTTGGGAGTTGGTAGGATACTCCCATGCATTTCCTGTT

TTTTGTTTGTTTGTTTGCTTTTTTGGGTTTTGTTTTTAATCTGTCCTGTGCAGAGTGCCACCTGTATCACGGTACATCATGTTTATACTACTATGTCAAG

ATTAAGCTTAAAGTATACATACAGAGTTGATTTTTATACCCTCTTGAAGGTTTGGAGCTATTGCCCTGGCTGTATATGACTGAAGCTGAGAGAGATCATG

CTACGTTTTGTCTCTCGTTCTGATATTTGTGTCTTTGTATGGTTGACAGCATGCAGTAAGCAATATAAAACACCAAGCCTTACGTCTATCAGAAAGAAGT

TTAATATATAAAATTCTGAACATATAAATATATTTAAGTGACAATACTAGAGTTTTAAGGAAGTGTGTACTCCAGGACGGGGACTCCAGGGCGGGGACTC

AATACTGTACTTAGAAGCTTCTTCAGAATTAGGGAAACATTCATTTCCTTGGGGAGAAAGTTTAGAGGTTAAAAATAGATTCTCTATTTTAAAAAGTTAA

ATTATAATTTGGAAGAAATTTCTTTGACTATAGAACACAGCAATTTAAAGGAATTTTGTTTGAAATTTTGTATTTTTGTGCCTTAATATTTGGTTTTTTA

ATAAATTGCTTTCTGACATTTGG
Translation
 MFNSTEIKFSV - UNI23459 - VKSFSCSGPVKFTIEWHLKYHTCHNDYPDLEE ELSQRHELHADPDVCAYFKNIDCWTTKSENLDCSSDSQAFP

SLN - UNI1793 - NKELTGIRNISSQEGST DVVARTQKDGFHIFIVSIKTEKTDAVWDLNV VSLSMVGPHGYISASDWPLMI - UNI8825 - 

FYMVMCIVYILYGVLWLLWSACYWKDILRIQFWIAAVIFLGMLEKAVFYSEYQNINSTGLST TQGLLIFAELISAVKRTLARLLVIIVSLGYGIVK KP

RLGTVMHRVIGLGLLYLIFAAIEGVMRVIG - UNI3235 - GSKHLAVVLTDIVLAVIDSIFVWFISFTMSFQNSWC CLAQTMKTLRLRKNTVKFSL

YRHFTNTLIFAVLA ASIVFMVWTTKTFRIAKCQS - UNI419 - DWMELWVDDAFWSFLFSVILIVIMFLWRPSANNQR RYAFMPLIDDSDDEVEE

FMVTSENLT TEGIKLRASKTVSNGTAKPTSDNF DEDLKWVEENIPSSFTDV VALPVLVDSDE EIMTRSEIAEKMFSSEKIM

For any suggestions or comments, please send an email to unitrap@crg.es