Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014361 (Mertk)
Chromosomal location
Chr 2: 128524733 - 128627924 (+)
Description
c-mer proto-oncogene tyrosine kinase Gene [Source:MGI (curated);Acc:Mertk-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35506
Vector Insertion
Chr 2: 128609747 - 128615952
Public Clones IST14639G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000014505
Sequence
TGGATACGTGCATCTGTCCGGAGAGAACTGCCAGATCCGCGGCCCCGCGATGGTTCTGGCCCCACTGCTACTGGGGCTGCTGCTGCTACCCGCGCTCTGG

AGTGGAG GCACTGCCGAGAAGTGGGAAGAGACCGAGCTAGATCAGCTATTTTCAGGGCCTTTACCAGGGAGACTCCCAGTCAACCACAGGCCATTCTCT

GCTCCTCACTCCAGCCGGGACCAGCTGCCACCACCCCAGACTGGAAGATCACATCCAGCACACACAGCCGCTCCCCAGGTGACCTCCACAGCATCAAAGC

TCCTACCTCCTGTTGCGTTTAATCACACCATTGGACACATAGTACTGTCGGAACATAAAAATGTCAAATTTAATTGCTCCATCAATATTCCTAACACATA

CCAAGAAACAGCTGGCATTTCATGGTGGAAAGATGGAAAGGAATTGCTCGGGGCACATCATTCAATCACACAGTTTTATCCTGATGAGGAAGGGGTATCA

ATAATTGCATTGTTCAG CATAGCCAGTGTGCAGCGCTCAGACAATGGGTCGTACTTCTGTAAGATGAAGGTGAACAATAGAGAGATTGTATCTGATCCC

ATATACGTGGAAGTTCAAG GACTCCCTTACTTTATTAAGCAGCCTGAGAGTGTGAATGTCACCAGAAACACAGCCTTCAACCTCACCTGCCAGGCCGTG

GGCCCTCCTGAGCCCGTCAATATCTTCTGGGTTCAAAATAGCAGCCGTGTTAATGAAAAACCGGAAAGGTCCCCGTCTGTCCTAACCGTACCTG GTCTG

ACAGAGACAGCAGTCTTCAGCTGTGAGGCCCACAATGACAAAGGACTGACGGTGTCCAAGGGTGTACATATCAACATCAAAG TAATCCCCTCCCCGCCC

ACTGAAGTCCATATCCTCAACAGTACAGCACACAGCATCCTGGTCTCCTGGGTCCCTGGTTTTGATGGCTACTCCCCACTTCAGAACTGCAGCATTCAG 

GTCAAGGAAGCTGACCGGCTGAGTAATGGCTCAGTCATGGTTTTTAATACCTCTGCTTCGCCACATCTGTATGAGATCCAGCAGCTGCAAGCCCTGGCTA

ATTACAGCATCGCTGTGTCCTGTCGGAATGAGATTGGCTGGTCTGCAGTAAGCCCTTGGATTCTGGCCAGCACAACAGAAGGAG CTCCATCTGTAGCAC

CTTTAAACATCACTGTGTTTCTGAACGAATCTAACAATATCCTGGATATTAGATGGACGAAGCCTCCAATTAAGCGGCAGGATGGGGAACTGGTGGGCTA

CCGGATATCTCACGTGTGGGAAAGCGCAGGGACTTAC AAAGAGCTTTCTGAAGAAGTCAGCCAGAATGGCAGCTGGGCTCAGATTCCTGTCCAAATCCA

CAATGCCACCTGCACAGTGAGAATCGCGGCCATTACTAAAGGGGGCATCGGGCCCTTCAGTGAGCCAGTGAATATCATCATTCCTGAACACA GTAAGGT

AGATTACGCACCCTCGTCAACCCCAGCCCCTGGCAACACCGACTCTATGTTCATCATCCTCGGCTGCTTCTGTGGATTCATTTTAATCGGGTTAATTTTG

TGTATTTCTCTGGCCCTCAGAAGGAGAGTCCAGGAAACAAAGTTTGG GGGAGCATTCTCTGAGGAGGATTCCCAACTGGTCGTAAATTATAGAGCGAAG

AAGTCCTTCTGCCGGCGAGCCATCGAGCTTACCT TGCAGAGCCTGGGAGTGAGCGAGGAGCTGCAGAATAAGCTGGAAGATGTTGTGATTGACAGAAAC

CTTCTGGTTCTCGGCAAAGTTCTGGGTGAAG GAGAGTTTGGGTCTGTAATGGAAGGAAATTTGAAGCAAGAAGATGGGACTTCTCAGAAGGTGGCAGTG

AAGACCATGAAGT TGGACAACTTTTCTCAACGGGAGATCGAGGAGTTTCTCAGCGAAGCAGCATGCATGAAAGACTTCAACCACCCAAATGTCATCCGA

CTTCTAG GCGTGTGTATAGAACTGAGCTCTCAAGGCATCCCGAAGCCCATGGTGATTTTACCCTTCATGAAATACGGAGACCTCCACACCTTCCTGTTA

TATTCCCGATTAAACACAGGACCCAAG - UNI35506 - TACATTCACCTGCAGACACTACTGAAGTTCATGATGGACATTGCCCAGGGAATGGAGTA

TCTGAGCAACAGGAATTTTCTTCATAGGGATTTGGCAGCTCGAAACTGCAT GTTGCGGGATGACATGACTGTCTGCGTGGCAGACTTTGGCCTCTCAAA

GAAGATTTACAGTGGTGATTATTACCGCCAAGGCCGCATTGCCAAAATGCCTGTGAAGTGGATCGCCATCGAGAGCCTGGCGGACCGAGTCTACACAAGC

AAAAGTGACGTG TGGGCTTTTGGCGTGACCATGTGGGAAATAACAACACGGGGAATGACTCCCTATCCCGGAGTTCAGAACCATGAGATGTACGACTAC

CTTCTCCACGGCCACAGGCTGAAGCAGCCTGAGGACTGCTTGGATGAACT GTATGACATCATGTACTCTTGCTGGAGTGCTGATCCCTTGGATCGACCC

ACCTTCTCTGTGTTGAGGCTGCAGCTGGAAAAGCTCTCCGAGAGTTTGCCTGATGCGCAGGACAAAGAATCCATCATCTACATCAATACCCAGTTGCTAG

AGAGCTGCGAGGGCATAGCCAATGGGCCCTCACTCACGGGGCTAGACATGAACATTGACCCTGACTCCATCATTGCCTCTTGCACACCAGGCGCTGCCGT

CAGCGTGGTCACGGCAGAAGTTCACGAGAACAACCTTCGTGAGGAAAGATACATCTTGAATGGGGGCAATGAGGAATGGGAAGATGTGTCCTCCACTCCT

TTTGCTGCAGTCACACCTGAAAAGGATGGTGTCTTACCGGAGGACAGACTCACCAAAAATGGCGTCTCCTGGTCTCACCATAGTACACTACCCTTGGGGA

GCCCATCACCAGATGAACTTTTATTTGTAGATGACTCCTTGGAAGACTCTGAAGTTCTGATGTGAAGCCAGCTGAGAGGAGGCATGAGAGAACCAAGCAA

ATACAGCTTCCTGGGATCTGGTGGTCTTAGATACTTTGTTATTGCTCTGATAAAACATCATGACCAAGGCAATCTTCAAGAGAAAGTGTTTAACTAGGTT

TACTGTTTCAGGGGGTTAGAGTCTATGATTGCAGAAGGAAGTTATGATGGCAGGAACAGCTGAGTGCTTATATCTTTAAGAGCAAGCAGGAGACAGAGAG

CACTCTGGGAAATGGCACCTATCTTTTGAAACCTCAAAGCCTGCTCCCAGTGACAAAAGTCCTTCAACAGGCCATACCTCCTAATCCTTCCCAAACAATT

CCACCAACTGGAGACCAAACATTCAAATGTATGCGCGTATTGGGGCCATTCTTAAGCAAACCACTACACTGGTTATACCTGAGGTTTTGGTACTTGTTTT

CCTTACCAAGTAGAGTTCATGGCCGGACAGCACCAGGTGAAAGCTGTCAAGTCAGGTTTGCAAATACATAACCAAGGTCTTGAGAG
Translation
MVLAPLLLGLLLLPALWSGG GTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIV

LSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFS SIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQG GLPYF

IKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPG GLTETAVFSCEAHNDKGLTVSKGVHINIKV VIPSPPTEVHILNS

TAHSILVSWVPGFDGYSPLQNCSIQ VKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGA APSVAPLNITV

FLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTY KELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHS SKVDYA

PSSTPAPGNTDSMFIILGCFCGFILIGLILCISLALRRRVQETKFG GGAFSEEDSQLVVNYRAKKSFCRRAIELTL LQSLGVSEELQNKLEDVVIDRN

LLVLGKVLGEG GEFGSVMEGNLKQEDGTSQKVAVKTMKL LDNFSQREIEEFLSEAACMKDFNHPNVIRLLG GVCIELSSQGIPKPMVILPFMKYGDL

HTFLLYSRLNTGPK - UNI35506 - YIHLQTLLKFMMDIAQGMEYLSNRNFLHRDLAARNCM MLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMP

VKWIAIESLADRVYTSKSDV WAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDEL LYDIMYSCWSADPLDRPTFSVLRLQLEKLSES

LPDAQDKESIIYINTQLLESCEGIANGPSLTGLDMNIDPDSIIASCTPGAAVSVVTAEVHENNLREERYILNGGNEEWEDVSSTPFAAVTPEKDGVLPED

RLTKNGVSWSHHSTLPLGSPSPDELLFVDDSLEDSEVLM

For any suggestions or comments, please send an email to unitrap@crg.es