Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014426 (Map3k4)
Chromosomal location
Chr 17: 12420489 - 12511614 (-)
Description
mitogen-activated protein kinase kinase kinase 4 Gene [Source:MGI Symbol;Acc:MGI:1346875]
RefSeq_dna
NM_011948 
RefSeq_peptide
NP_036078.2 
UniGene
Mm.413344 Mm.28587 
MGI
MGI:1346875 
Uniprot/SWISSPROT
O08648 
Uniprot/SPTREMBL
Q3UZV9 Q8K4X6 Q9CRU1 Q6PDG6 Q80U64 
Human Ortholog
ENSG00000085511 (MAP3K4)
Omim not available
UniTrap UNI10455
Vector Insertion
Chr 17: 12470978 - 12511363
Public Clones D056D07 (ggtc) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7595
Vector Insertion
Chr 17: 12457015 - 12463728
Public Clones RRN121 (baygenomics) RRR430 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32067
Vector Insertion
Chr 17: 12429846 - 12431097
Public Clones IST13054G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074585
Sequence
CCTGCGGCGGGCTAGAGGCGGAGGCGGAGTCGAGTCACTCCCTCACCCCGCGGCTCCTGGTCTTCCCGCACCAGGCTGCAGCTGACGACCCGCCGCGGTC

ATGCGAAGCTTGGTGCACGGATGAGAGACGCCATCGCCGAGCCGGTGCCCCCTCCTGCCCTCGCCGACACCCCTGCAGCCGCCATGGAGGAGCTGCGGCC

AGCACCGCCGCCACAGCCCGAGCCGGATCCGGAGTGCTGCCCAGCGGCGAG - UNI10455 - GCAGGAGTGCATGTTGGGAGAGTCGGCTCGCAAAA

GTATGGAATCCGATCCAGAGGACTTTTCTGATGAAACAAATACAGAGACTCTCTACGGCACCTCACCCCCAAGCACACCTCGACAGATGAAACGCCTGTC

AGCCAAGCACCAGAGGAACAGCGCAGGGAGGCCGGCCAGCCGATCGAACTTGAAAG AAAAAATGAACACACCGAGTCAGTCTCCACATAAAGATTTGGG

GAAGGGAGTGGAGACCGTGGAAGAATACAGCTACAAGCAGGAGAAGAAGATTCGAGCAACTCTGAGAACAACGGAGCGAGACCATAAGAAAAATGCACAG

TGCTCGTTCATGTTGGACTCGGTGGCTGGGTCTTTGCCAAAAAAATCGATTCCAGATGTGGATCTCAATAAGCCTTACCTCAGTCTCGGCTGTAGCAATG

CCAAGCTGCCCGTCTCGATGCCCATGCCGATAGCCAGAACTGCACGGCAGACTTCCCGGACTGACTGCCCCGCAGATCGCTTAAAGTTCTTTGAAACACT

GCGCCTTTTGCTAAAGCTTACCTCAGTCTCGAAGAAGAAGGACAGGGAGCAGAGGGGACAAGAAAACACGGCTGCTTTCTGGTTCAACCGATCGAACGAA

CTGATCTGGTTAGAACTGCAGGCCTGGCACGCGGGCCGCACCATCAATGACCAGGACCTCTTTCTCTACACAGCCCGCCAGGCCATCCCAGACATCATCA

ATGAGATCCTCACCTTCAAAGTTAACTACGGGAGCATTGCCTTCTCCAGCAATGGAGCCGGTTTCAACGGGCCCTTGGTAGAAGGCCAGTGCAGAACCCC

TCAGGAGACAAACCGTGTGGGCTGCTCATCGTACCACGAGCACCTCCAGCGCCAGAGGGTCTCGTTTGAGCAGGTGAAGCGGATAATGGAGCTGCTGGAG

TACATGGAGGCACTTTACCCATCCTTGCAGGCTCTGCAGAAGGACTATGAACGGTACGCCGCCAAGGACTTTGAGGACAGAGTGCAGGCGCTCTGCCTGT

GGCTCAACATCACGAAAGATCTAAATCAGAAGCTGCGGATCATGGGCACCGTGCTGGGCATCAAGAACCTATCAGACATTGGCTGGCCAGTGTTTGAAAT

CCCCTCCCCTCGGCCGTCCAAGGGCTACGAGCCAGAGGACGAGGTCGAGGACACGGAGGTTGAGCTGAGGGAGCTGGAGAGCGGGACGGAGGAGAGTGAC

GAGGAGCCAACCCCCAGTCCGAGGGTGCCAGAGCTCAGGCTGTCCACAGACGCCATCTTGGACAGTCGCTCCCAGGGCTGCGTCTCCAGGAAGCTGGAGA

GGCTCGAGTCAGAGGAAGATTCCATAGGCTGGGGGACAGCGGACTGTGGCCCTGAAGCCAGCAGGCATTGTTTGACTTCTATCTATAGACCATTCGTGGA

CAAAGCACTGAAGCAAATGGGGCTAAGAAAGTTAATTTTACGACTTCATAAGCTTATGAATGGGTCCTTGCAAAGAGCTCGTGTAGCTCTGGTGAAGGAC

GACCGTCCAGTGGAG - UNI7595 - TTCTCTGACTTTCCAGGTCCCATGTGGGGCTCGGATTATGTGCAGTTGTCGGGAACACCTCCTTCCTCAGAG

CAGAAGTGTAGCGCTGTGTCCTGGGAAGAACTGAGAGCCATGGACCTGCCTTCCTTTGAGCCCGCCTTCCTGGTGCTCTGTCGGGTCCTGCTGAACGTGA

TCCACGAGTGCCTGAAGCTGCGGCTGGAACAGAGGCCTGCCGGGGAGCCTTCCCTCTTGAGTATCAAACAG CTAGTGCGAGAGTGTAAAGAGGTCCTAA

AGGGCGGGCTCCTGATGAAGCAGTATTACCAGTTCATGCTGCAGGAGGTCCTGGGCGGACTGGAGAAGACCGACTGCAACATGGATGCCTTTGAGGAGGA

CCTGCAGAAGATGCTGATG GTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAGTTACCTCAGGCTTCCCATAGCTTAAAAAACCTGCT

AGAAGAGGAATGGAATTTCACCAAAGAAATAACCCATTATATCCGTGGCGGAGAAGCGCAGGCTGGAAAGCTTTTCTG TGACATCGCAGGGATGCTGCT

GAAATCCACAGGGAGCTTTCTGGAATCCGGCCTGCAGGAGAGCTGTGCTGAGCTGTGGACCAGCGCCGACGACAACGGTGCTGCCGACGAGCTAAG GAG

ATCTGTCATCGAGATCAGCCGAGCACTCAAGGAGCTCTTCCACGAAGCCAGGGAAAGAGCCTCCAAGGCCCTGGGCTTTGCTAAAATGCTGAGGAAG GA

CCTAGAAATAGCAGCAGAGTTCGTGCTATCTGCATCAGCCCGAGAGCTCCTGGACGCTCTGAAAGCAAAGCAGTATGTTAAG GTACAGATTCCCGGGTT

AGAGAATTTGCACGTGTTTGTCCCCGACAGCCTCGCTGAGGAGAAGAAAATTATTTTGCAGCTACTCAATGCTGCCACAGGAAAGGACTGCTCAAAGGAT

CCAGACGACGTCTTCATGGATGCCTTCCTGCTCCTGACCAAGCATGGGGACCGAGCCCGTGACTCAGAAGATGGCTGGGGCACATGGGAAGCTCGGGCTG

TCAAAATTGTGCCTCAGGTGGAGACTGTGGACACCCTGAGAAGCATGCAG GTGGACAACCTTCTGCTGGTTGTCATGGAGTCTGCTCACCTCGTACTTC

AGAGAAAAGCCTTCCAGCAGTCCATTGAGGGGCTGATGACTGTACGCCATGAGCAGACATCTAGCCAGCCCATCATCGCCAAAGGTTTGCAGCAGCTCAA

G AACGATGCACTTGAGCTATGCAACAGAATCAGCGATGCCATCGACCGTGTGGACCACATGTTCACCCTGGAGTTCGATGCTGAGGTCGAGGAGTCTGA

GTCGGCCACGCTGCAGCAGTACTACCGAGAAGCCATGATTCAGGGCTACAACTTTGGGTTTGAG TATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGA

ATTCAGGCAGAAGATAGGAGACAAATATATAAGCTTCGCCCAGAAGTGGATGAATTACGTGCTGACCAAATGCGAGAGCGGCAGAGGCACAAGACCCAG 

ATGGGCCACCCAAGGATTTGATTTCCTACAAGCCATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTG AGTTTGCAAGCCCTGATGAA

TGAGTGCATCGGGCACGTCATAGGAAAGCCACACAGCCCTGTCACAG CTATCCATCGGAACAGCCCCCGCCCTGTGAAGGTGCCCCGATGCCACAGTGA

CCCTCCTAACCCTCACCTCATCATCCCGACTCCAGAGGGATTCAG GGGTTCCAGTGTCCCTGAAAACGACCGCTTGGCCTCCATAGCTGCAGAACTGCA

GTTCAGGTCTCTGAGTCGGCACTCAAGCCCCACGGAAGAGCGAGACG AGCCAGCGTATCCTCGGAGTGACTCAAGTGGATCAACTCGGAGAAGCTGGGA

ACTTCGAACACTCATCAGCCAGACCAAAG - UNI32067 - ACTCGGCCTCTAAGCAGGGGCCCATAGAAGCTATCCAGAAGTCAGTCCGACTGTTTG

AAGAGAGGAGGTATCGAGAGATGAGGAGAAAGAATATCATCGGCCAAGTGTGCGATACCCCTAAGTCCTATGATAACGTCATGCATGTTGGACTGAGGAA

GGTGACATTTAAGTGGCAAAGAGGAAACAAAATTG - UNI32067 - GAGAAGGACAGTATGGAAAAGTATACACCTGCATCAGTGTTGACACAGGGG

AGCTGATGGCCATGAAGGAG - UNI32067 - ATTCGATTTCAGCCTAACGACCACAAGACTATCAAGGAGACTGCAGACGAGTTGAAAATATTTGAA

GGCATCAAGCACCCCAACCTGGTCCGGTATTTTGGCGTGGAGCTTCACAGG GAAGAGATGTACATCTTCATGGAGTACTGTGATGAGGGTACACTAGAG

GAGGTGTCACGACTGGGCCTGCAGGAGCACGTCATCAGGTTATATACCAAGCAGATCACTGTCGCCATCAACGTCCTCCATGAGCACGGCATCGTTCACC

GAGACATCAAAG GTGCCAATATCTTCCTTACGTCATCTGGACTAATCAAGCTGGGAGATTTTGGATGCTCTGTAAAACTTAAAAACAACGCCCAGACCA

TGCCCGGAGAGGTGAACAGCACCCTAGGGACAGCAG CTTACATGGCCCCTGAAGTTATTACCCGAGCCAAAGGAGAAGGCCACGGACGTGCGGCAGATA

TCTGGAGTCTGGGGTGCGTCGTCATAGAGATGGTGACTGGCAAG CGGCCTTGGCATGAGTATGAACACAACTTTCAGATTATGTACAAGGTGGGGATGG

GACACAAGCCACCAATCCCGGAAAGGCTAAGCCCTGAAGGAAAGGCCTTTCTCTCGCACTGCCTGGAAAGTGACCCGAAGATACGGTGGACAGCCAGCCA

GCTCCTCGACCACGCTTTTGTCAAG GTTTGCACAGATGAAGAGTGAAGTGAACCAGTCCGTGGCCTAGTAGTGTGTGGACAGAATCCCGTGATCACTAC

TGTATGTAATATTTACATAAAGACTGCAGCGCAGGCGGCCTTCCTAACCTCCCAGGACTGAAGACTACAGGGGTGACAAGCCTCACTTCTGCTGCTCCTG

TCGCCTGCTGAGTGACAGTGCTGAGGTTAAAGGAGCCGCACGTTAAGTGCCATTACTACTGTACACGGGCCACCGCCTCTGTCCCCTCCGACCCTCTCGT

GACTGAGAACCAACCGTGTCATCAGCACAGTGTTTTTGAGCTCCTGGGGTTCAGAAGAACATGTAGTGTTCCCGGGTGTCCGGGACGTTTATTTCAACCT

CCTGGTCGTTGGCTCTGACTGTGGAGCCTCCTTGTTCGAAAGCTGCAGGTTTGTTATGCAAAGGCTCGTAAGTGAAGCTGAAGAAAAGGTTCTTTTTCAA

TAAATGGTTTATTTTAGGAAAGCG
Translation
MRDAIAEPVPPPALADTPAAAMEELRPAPPPQPEPDPECCPAAR - UNI10455 - RQECMLGESARKSMESDPEDFSDETNTETLYGTSPPSTPRQM

KRLSAKHQRNSAGRPASRSNLKE EKMNTPSQSPHKDLGKGVETVEEYSYKQEKKIRATLRTTERDHKKNAQCSFMLDSVAGSLPKKSIPDVDLNKPYLS

LGCSNAKLPVSMPMPIARTARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQA

IPDIINEILTFKVNYGSIAFSSNGAGFNGPLVEGQCRTPQETNRVGCSSYHEHLQRQRVSFEQVKRIMELLEYMEALYPSLQALQKDYERYAAKDFEDRV

QALCLWLNITKDLNQKLRIMGTVLGIKNLSDIGWPVFEIPSPRPSKGYEPEDEVEDTEVELRELESGTEESDEEPTPSPRVPELRLSTDAILDSRSQGCV

SRKLERLESEEDSIGWGTADCGPEASRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMNGSLQRARVALVKDDRPVE - UNI7595 - FSDFPGPMWG

SDYVQLSGTPPSSEQKCSAVSWEELRAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQ LVRECKEVLKGGLLMKQYYQFMLQEVLG

GLEKTDCNMDAFEEDLQKMLM VYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFC CDIAGMLLKSTGSFLESGLQESCA

ELWTSADDNGAADELR RRSVIEISRALKELFHEARERASKALGFAKMLRK DLEIAAEFVLSASARELLDALKAKQYVK VQIPGLENLHVFVPDSLAE

EKKIILQLLNAATGKDCSKDPDDVFMDAFLLLTKHGDRARDSEDGWGTWEARAVKIVPQVETVDTLRSMQ VDNLLLVVMESAHLVLQRKAFQQSIEGLM

TVRHEQTSSQPIIAKGLQQLK NDALELCNRISDAIDRVDHMFTLEFDAEVEESESATLQQYYREAMIQGYNFGFE YHKEVVRLMSGEFRQKIGDKYIS

FAQKWMNYVLTKCESGRGTRPR RWATQGFDFLQAIEPAFISALPEDDFL SLQALMNECIGHVIGKPHSPVTA AIHRNSPRPVKVPRCHSDPPNPHLI

IPTPEGFR RGSSVPENDRLASIAAELQFRSLSRHSSPTEERDE EPAYPRSDSSGSTRRSWELRTLISQTKD - UNI32067 - DSASKQGPIEAIQ

KSVRLFEERRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIG - UNI32067 - GEGQYGKVYTCISVDTGELMAMKE - UNI3206

7 - IRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHR EEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYTKQITVAINVLHEHGIVHRDIKG G

ANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAA AYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGK RPWHEYEHNFQIMYKVGMGHK

PPIPERLSPEGKAFLSHCLESDPKIRWTASQLLDHAFVK VCTDEE
Transcript ENSMUST00000089058
Sequence
CCTGCGGCGGGCTAGAGGCGGAGGCGGAGTCGAGTCACTCCCTCACCCCGCGGCTCCTGGTCTTCCCGCACCAGGCTGCAGCTGACGACCCGCCGCGGTC

ATGCGAAGCTTGGTGCACGGATGAGAGACGCCATCGCCGAGCCGGTGCCCCCTCCTGCCCTCGCCGACACCCCTGCAGCCGCCATGGAGGAGCTGCGGCC

AGCACCGCCGCCACAGCCCGAGCCGGATCCGGAGTGCTGCCCAGCGGCGAG - UNI10455 - GCAGGAGTGCATGTTGGGAGAGTCGGCTCGCAAAA

GTATGGAATCCGATCCAGAGGACTTTTCTGATGAAACAAATACAGAGACTCTCTACGGCACCTCACCCCCAAGCACACCTCGACAGATGAAACGCCTGTC

AGCCAAGCACCAGAGGAACAGCGCAGGGAGGCCGGCCAGCCGATCGAACTTGAAAG AAAAAATGAACACACCGAGTCAGTCTCCACATAAAGATTTGGG

GAAGGGAGTGGAGACCGTGGAAGAATACAGCTACAAGCAGGAGAAGAAGATTCGAGCAACTCTGAGAACAACGGAGCGAGACCATAAGAAAAATGCACAG

TGCTCGTTCATGTTGGACTCGGTGGCTGGGTCTTTGCCAAAAAAATCGATTCCAGATGTGGATCTCAATAAGCCTTACCTCAGTCTCGGCTGTAGCAATG

CCAAGCTGCCCGTCTCGATGCCCATGCCGATAGCCAGAACTGCACGGCAGACTTCCCGGACTGACTGCCCCGCAGATCGCTTAAAGTTCTTTGAAACACT

GCGCCTTTTGCTAAAGCTTACCTCAGTCTCGAAGAAGAAGGACAGGGAGCAGAGGGGACAAGAAAACACGGCTGCTTTCTGGTTCAACCGATCGAACGAA

CTGATCTGGTTAGAACTGCAGGCCTGGCACGCGGGCCGCACCATCAATGACCAGGACCTCTTTCTCTACACAGCCCGCCAGGCCATCCCAGACATCATCA

ATGAGATCCTCACCTTCAAAGTTAACTACGGGAGCATTGCCTTCTCCAGCAATGGAGCCGGTTTCAACGGGCCCTTGGTAGAAGGCCAGTGCAGAACCCC

TCAGGAGACAAACCGTGTGGGCTGCTCATCGTACCACGAGCACCTCCAGCGCCAGAGGGTCTCGTTTGAGCAGGTGAAGCGGATAATGGAGCTGCTGGAG

TACATGGAGGCACTTTACCCATCCTTGCAGGCTCTGCAGAAGGACTATGAACGGTACGCCGCCAAGGACTTTGAGGACAGAGTGCAGGCGCTCTGCCTGT

GGCTCAACATCACGAAAGATCTAAATCAGAAGCTGCGGATCATGGGCACCGTGCTGGGCATCAAGAACCTATCAGACATTGGCTGGCCAGTGTTTGAAAT

CCCCTCCCCTCGGCCGTCCAAGGGCTACGAGCCAGAGGACGAGGTCGAGGACACGGAGGTTGAGCTGAGGGAGCTGGAGAGCGGGACGGAGGAGAGTGAC

GAGGAGCCAACCCCCAGTCCGAGGGTGCCAGAGCTCAGGCTGTCCACAGACGCCATCTTGGACAGTCGCTCCCAGGGCTGCGTCTCCAGGAAGCTGGAGA

GGCTCGAGTCAGAGGAAGATTCCATAGGCTGGGGGACAGCGGACTGTGGCCCTGAAGCCAGCAGGCATTGTTTGACTTCTATCTATAGACCATTCGTGGA

CAAAGCACTGAAGCAAATGGGGCTAAGAAAGTTAATTTTACGACTTCATAAGCTTATGAATGGGTCCTTGCAAAGAGCTCGTGTAGCTCTGGTGAAGGAC

GACCGTCCAGTGGAG - UNI7595 - TTCTCTGACTTTCCAGGTCCCATGTGGGGCTCGGATTATGTGCAGTTGTCGGGAACACCTCCTTCCTCAGAG

CAGAAGTGTAGCGCTGTGTCCTGGGAAGAACTGAGAGCCATGGACCTGCCTTCCTTTGAGCCCGCCTTCCTGGTGCTCTGTCGGGTCCTGCTGAACGTGA

TCCACGAGTGCCTGAAGCTGCGGCTGGAACAGAGGCCTGCCGGGGAGCCTTCCCTCTTGAGTATCAAACAG CTAGTGCGAGAGTGTAAAGAGGTCCTAA

AGGGCGGGCTCCTGATGAAGCAGTATTACCAGTTCATGCTGCAGGAGGTCCTGGGCGGACTGGAGAAGACCGACTGCAACATGGATGCCTTTGAGGAGGA

CCTGCAGAAGATGCTGATG GTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAGTTACCTCAGGCTTCCCATAGCTTAAAAAACCTGCT

AGAAGAGGAATGGAATTTCACCAAAGAAATAACCCATTATATCCGTGGCGGAGAAGCGCAGGCTGGAAAGCTTTTCTG TGACATCGCAGGGATGCTGCT

GAAATCCACAGGGAGCTTTCTGGAATCCGGCCTGCAGGAGAGCTGTGCTGAGCTGTGGACCAGCGCCGACGACAACGGTGCTGCCGACGAGCTAAG GAG

ATCTGTCATCGAGATCAGCCGAGCACTCAAGGAGCTCTTCCACGAAGCCAGGGAAAGAGCCTCCAAGGCCCTGGGCTTTGCTAAAATGCTGAGGAAG GA

CCTAGAAATAGCAGCAGAGTTCGTGCTATCTGCATCAGCCCGAGAGCTCCTGGACGCTCTGAAAGCAAAGCAGTATGTTAAG GTACAGATTCCCGGGTT

AGAGAATTTGCACGTGTTTGTCCCCGACAGCCTCGCTGAGGAGAAGAAAATTATTTTGCAGCTACTCAATGCTGCCACAGGAAAGGACTGCTCAAAGGAT

CCAGACGACGTCTTCATGGATGCCTTCCTGCTCCTGACCAAGCATGGGGACCGAGCCCGTGACTCAGAAGATGGCTGGGGCACATGGGAAGCTCGGGCTG

TCAAAATTGTGCCTCAGGTGGAGACTGTGGACACCCTGAGAAGCATGCAG GTGGACAACCTTCTGCTGGTTGTCATGGAGTCTGCTCACCTCGTACTTC

AGAGAAAAGCCTTCCAGCAGTCCATTGAGGGGCTGATGACTGTACGCCATGAGCAGACATCTAGCCAGCCCATCATCGCCAAAGGTTTGCAGCAGCTCAA

G AACGATGCACTTGAGCTATGCAACAGAATCAGCGATGCCATCGACCGTGTGGACCACATGTTCACCCTGGAGTTCGATGCTGAGGTCGAGGAGTCTGA

GTCGGCCACGCTGCAGCAGTACTACCGAGAAGCCATGATTCAGGGCTACAACTTTGGGTTTGAG TATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGA

ATTCAGGCAGAAGATAGGAGACAAATATATAAGCTTCGCCCAGAAGTGGATGAATTACGTGCTGACCAAATGCGAGAGCGGCAGAGGCACAAGACCCAG 

ATGGGCCACCCAAGGATTTGATTTCCTACAAGCCATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTG AGTTTGCAAGCCCTGATGAA

TGAGTGCATCGGGCACGTCATAGGAAAGCCACACAGCCCTGTCACAG CTATCCATCGGAACAGCCCCCGCCCTGTGAAGGTGCCCCGATGCCACAGTGA

CCCTCCTAACCCTCACCTCATCATCCCGACTCCAGAGGGATTCAG CACCCGGAGCGTGCCTTCCGACGCTCGGACCCATGGCAACTCTGTTGCTGCTGC

TGCTGCTGTTGCTGCCGCCGCCACCACTGCTGCTGGCCGCCCTGGCCCAGGTGGTGGTGACTCTGTGCCAGCCAAACCTGTCAACACTGCCCCTGATACC

AG GGGTTCCAGTGTCCCTGAAAACGACCGCTTGGCCTCCATAGCTGCAGAACTGCAGTTCAGGTCTCTGAGTCGGCACTCAAGCCCCACGGAAGAGCGA

GACG AGCCAGCGTATCCTCGGAGTGACTCAAGTGGATCAACTCGGAGAAGCTGGGAACTTCGAACACTCATCAGCCAGACCAAAG - UNI32067 - 

ACTCGGCCTCTAAGCAGGGGCCCATAGAAGCTATCCAGAAGTCAGTCCGACTGTTTGAAGAGAGGAGGTATCGAGAGATGAGGAGAAAGAATATCATCGG

CCAAGTGTGCGATACCCCTAAGTCCTATGATAACGTCATGCATGTTGGACTGAGGAAGGTGACATTTAAGTGGCAAAGAGGAAACAAAATTG - UNI32

067 - GAGAAGGACAGTATGGAAAAGTATACACCTGCATCAGTGTTGACACAGGGGAGCTGATGGCCATGAAGGAG - UNI32067 - ATTCGATTT

CAGCCTAACGACCACAAGACTATCAAGGAGACTGCAGACGAGTTGAAAATATTTGAAGGCATCAAGCACCCCAACCTGGTCCGGTATTTTGGCGTGGAGC

TTCACAGG GAAGAGATGTACATCTTCATGGAGTACTGTGATGAGGGTACACTAGAGGAGGTGTCACGACTGGGCCTGCAGGAGCACGTCATCAGGTTAT

ATACCAAGCAGATCACTGTCGCCATCAACGTCCTCCATGAGCACGGCATCGTTCACCGAGACATCAAAG GTGCCAATATCTTCCTTACGTCATCTGGAC

TAATCAAGCTGGGAGATTTTGGATGCTCTGTAAAACTTAAAAACAACGCCCAGACCATGCCCGGAGAGGTGAACAGCACCCTAGGGACAGCAG CTTACA

TGGCCCCTGAAGTTATTACCCGAGCCAAAGGAGAAGGCCACGGACGTGCGGCAGATATCTGGAGTCTGGGGTGCGTCGTCATAGAGATGGTGACTGGCAA

G CGGCCTTGGCATGAGTATGAACACAACTTTCAGATTATGTACAAGGTGGGGATGGGACACAAGCCACCAATCCCGGAAAGGCTAAGCCCTGAAGGAAA

GGCCTTTCTCTCGCACTGCCTGGAAAGTGACCCGAAGATACGGTGGACAGCCAGCCAGCTCCTCGACCACGCTTTTGTCAAG GTTTGCACAGATGAAGA

GTGAAGTGAACCAGTCCGTGGCCTAGTAGTGTGTGGACAGAATCCCGTGATCACTACTGTATGTAATATTTACATAAAGACTGCAGCGCAGGCGGCCTTC

CTAACCTCCCAGGACTGAAGACTACAGGGGTGACAAGCCTCACTTCTGCTGCTCCTGTCGCCTGCTGAGTGACAGTGCTGAGGTTAAAGGAGCCGCACGT

TAAGTGCCATTACTACTGTACACGGGCCACCGCCTCTGTCCCCTCCGACCCTCTCGTGACTGAGAACCAACCGTGTCATCAGCACAGTGTTTTTGAGCTC

CTGGGGTTCAGAAGAACATGTAGTGTTCCCGGGTGTCCGGGACGTTTATTTCAACCTCCTGGTCGTTGGCTCTGACTGTGGAGCCTCCTTGTTCGAAAGC

TGCAGGTTTGTTATGCAAAGGCTCGTAAGTGAAGCTGAAGAAAAGGTTCTTTTTCAATAAATGGTTTATTTTAGGAAAGCG
Translation
MRDAIAEPVPPPALADTPAAAMEELRPAPPPQPEPDPECCPAAR - UNI10455 - RQECMLGESARKSMESDPEDFSDETNTETLYGTSPPSTPRQM

KRLSAKHQRNSAGRPASRSNLKE EKMNTPSQSPHKDLGKGVETVEEYSYKQEKKIRATLRTTERDHKKNAQCSFMLDSVAGSLPKKSIPDVDLNKPYLS

LGCSNAKLPVSMPMPIARTARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQA

IPDIINEILTFKVNYGSIAFSSNGAGFNGPLVEGQCRTPQETNRVGCSSYHEHLQRQRVSFEQVKRIMELLEYMEALYPSLQALQKDYERYAAKDFEDRV

QALCLWLNITKDLNQKLRIMGTVLGIKNLSDIGWPVFEIPSPRPSKGYEPEDEVEDTEVELRELESGTEESDEEPTPSPRVPELRLSTDAILDSRSQGCV

SRKLERLESEEDSIGWGTADCGPEASRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMNGSLQRARVALVKDDRPVE - UNI7595 - FSDFPGPMWG

SDYVQLSGTPPSSEQKCSAVSWEELRAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQ LVRECKEVLKGGLLMKQYYQFMLQEVLG

GLEKTDCNMDAFEEDLQKMLM VYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFC CDIAGMLLKSTGSFLESGLQESCA

ELWTSADDNGAADELR RRSVIEISRALKELFHEARERASKALGFAKMLRK DLEIAAEFVLSASARELLDALKAKQYVK VQIPGLENLHVFVPDSLAE

EKKIILQLLNAATGKDCSKDPDDVFMDAFLLLTKHGDRARDSEDGWGTWEARAVKIVPQVETVDTLRSMQ VDNLLLVVMESAHLVLQRKAFQQSIEGLM

TVRHEQTSSQPIIAKGLQQLK NDALELCNRISDAIDRVDHMFTLEFDAEVEESESATLQQYYREAMIQGYNFGFE YHKEVVRLMSGEFRQKIGDKYIS

FAQKWMNYVLTKCESGRGTRPR RWATQGFDFLQAIEPAFISALPEDDFL SLQALMNECIGHVIGKPHSPVTA AIHRNSPRPVKVPRCHSDPPNPHLI

IPTPEGFS STRSVPSDARTHGNSVAAAAAVAAAATTAAGRPGPGGGDSVPAKPVNTAPDTR RGSSVPENDRLASIAAELQFRSLSRHSSPTEERDE E

PAYPRSDSSGSTRRSWELRTLISQTKD - UNI32067 - DSASKQGPIEAIQKSVRLFEERRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQ

RGNKIG - UNI32067 - GEGQYGKVYTCISVDTGELMAMKE - UNI32067 - IRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHR EE

MYIFMEYCDEGTLEEVSRLGLQEHVIRLYTKQITVAINVLHEHGIVHRDIKG GANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAA AYMA

PEVITRAKGEGHGRAADIWSLGCVVIEMVTGK RPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKAFLSHCLESDPKIRWTASQLLDHAFVK VCTDEE


For any suggestions or comments, please send an email to unitrap@crg.es