Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014496 (Ankrd28)
Chromosomal location
Chr 14: 32513201 - 32643601 (-)
Description
ankyrin repeat domain 28 Gene [Source:MGI Symbol;Acc:MGI:2145661]
RefSeq_dna
NM_001024604 
RefSeq_peptide
NP_001019775.1 
UniGene
Mm.37660 Mm.407940 
MGI
MGI:2145661 
Uniprot/SWISSPROT
Q505D1 
Uniprot/SPTREMBL
Q5DU34 
Human Ortholog
ENSG00000206560 (ANKRD28)
Omim not available
UniTrap UNI2886
Vector Insertion
Chr 14: 32592192 - 32643512
Public Clones (sanger) AE0180 (sanger) IST14793C6 (tigm) IST14948G9 (tigm)
Private Clones OST117613 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4402
Vector Insertion
Chr 14: 32577519 - 32592107
Public Clones AE0134 (sanger) XS0995 (sanger)
Private Clones OST372465 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000014640
Sequence
CTTCAACGTAGCCGGCCACCTACCCGCCGGGCGCGGGTAGTGGCCGAACAGCGGCGACCGCCATGGCGTTCCTCAAACTCCGCGACCAG - UNI2886 

- CCATCACTGGTGCAAGCTATATTTAATGGTGATCCAGATGAAGTCCGAGCACTAATATTTAAGAAAGAAGATGTTAACTTTCAG - UNI4402 - G

ACAATGAGAAGAGAACCCCTTTGCATGCTGCTGCCTATCTTGGTGACGCAGAAATCATTGAGCTGCTTATTTTATCTG GAGCTAGAGTTAATGCCAAAG

ACAGCAAATGGTTGACACCTTTACACAGAGCAGTTGCATCGTGTAGTGAG GAAGCAGTTCAGATACTTTTGAAGCATTCTGCAGATGTTAATGCTCGAG

ATAAAAATTGGCAGACCCCTTTACACATAGCTGCTGCTAATAAAGCTGTAAAGTGCGCTGAATCTTTGGTACCTCTTCTGAGCAATGTGAACGTGTCCGA

CCGAGCAGGAAGAACTGCATTACATCATGCAGCTTTCAGTGGGCATGGTGAG ATGGTCAAACTACTCTTGTCCAGAGGTGCCAATATAAATGCTTTTGA

CAAGAAAGATAGGCGTGCAATCCATTGGGCAGCATATATGG GTCACATTGAAGTAGTAAAATTACTTGTATCTCATGGAGCTGAAGTGACATGTAAGGA

TAAGAAGTCTTACACACCTCTTCATGCAGCAGCCTCTAGTGGAATGATCAGTGTAGTCAAATATCTTCTAGATCTTGGAGTTGAT ATGAATGAACCAAA

TGCCTATGGAAACACACCTCTTCATGTGGCCTGTTACAATGGACAAGATGTTGTTGTGAATGAGCTCATAGACTGTGGTGCTAATGTCAATCAGAAGAAT

GAGAAAGGGTTCACTCCTTTGCACTTTGCTGCTGCATCAACACATGGAGCACTGTGTTTAGAACTTCTGGTTGGCAATGGAGCTGATGTCAATATGAAG 

AGTAAAGATGGGAAAACCCCACTACATATGACTGCCCTCCACGGTAGATTCTCCAGATCACAAACGATTATCCAGAGTG GAGCTGTAATAGACTGTGAA

GATAAGAATGGGAACACCCCTTTGCATATAGCAGCCCGGTATGGCCATGAGCTTCTAATCAACACTCTTATTACAAGTGGTGCTGACACTGCAAA GCGT

GGTATACATGGAATGTTCCCACTCCATTTGGCAGCCTTAAGTGGTTTTTCAGATTGCTGCAGGAAACTCCTTTCTTCAG GATTTGACATAGATACCCCA

GATGATTTTGGCAGAACCTGTCTACACGCAGCTGCAGCTGGAGG AAATTTGGAGTGCCTAAACCTTCTGCTGAATACTGGTGCAGACTTCAACAAAAAG

GATAAATTTGGAAG ATCTCCACTGCACTATGCTGCTGCCAACTGCAATTACCAGTGCCTGTTTGCTCTTGTGGGATCAGGAGCAAGTGTGAATGACCTT

GATGAGAGAGGCTGCACACCCCTGCACTATGCAGCTACATCTGACACAGACGGCAA GTGCCTGGAATACTTACTAAGAAATGATGCCAACCCAGGGATC

CGGGACAAACAAGGCTATAATGCAGTTCACTACTCAGCTGCGTATGGTCACCGTCTGTGTCTTCAACTG ATTGCAAGTGAAACTCCTTTAGATGTT TT

AATGGAAACCTCGGGAACAGACATGTTGAGTGATTCAGATAATAGAGCAACAATAAGCCCTTTACATTTGGCT GCTTATCATGGTCACCATCAAGCCCT

GGAAGTGTTGGTACAGTCTTTGTTAGATCTTGATGTAAGAAATAGTAGTGGTAGAACACCCTTAGATCTTGCAGCCTTTAAGGGCCATGTTGAATGTGTG

GATGTACTCATTAATCAGGGAGCTTCAATCCTCGTAAAAGATTACGTTTTGAAGAGAACACCTATCCATGCAGCAG CAACAAATGGTCATTCAGAATGC

TTACGGTTATTAATAGGAAATGCAGAGCCACAGAATGCAGTAGATATTCAAGATGGAAATGGACA GACACCTCTTATGCTGTCGGTTCTCAATGGGCAC

ACGGACTGTGTATACTCACTACTGAACAAAGGAGCAAATGTAGATGCCAAAGACAAGTGGGGAAGGACAGCGTTGCACAGAGGG GCAGTGACAGGCCAT

GAAGAGTGTGTAGACGCATTACTTCAACATGGTGCTAAGTGCTTACTACGGGACAGCCGGGGTCGGACACCCATACACTTGTCAGCAGCCTGTGGACACA

TTGGAGTTCTTGGAGCCCTTTTGCAGTCAGCAACATCTGTGGATGCAAATCCAGCCGTAGTAGACAATCATGGGTATACAGCACTTCACTGGGCTTGCTA

CAATG GTCATGAGACATGTGTGGAGCTACTTTTAGAACAGGATGTTTTCCAGAAAATAGATGGAAATGCTTTCAGCCCCCTGCATTGTGCCGT GATCA

ACGACAATGAAGGTGCAGCTGAGATGCTGATTGATTCCTTAGGAGCCAGCATTGTGAATGCCACAGACTCAAAGGGAAG AACTCCTCTCCATGCCGCTG

CCTTCACAGACCATGTGGAGTGTTTACAACTGCTGCTCAGCCAGAATGCTCAGGTCAATTCCGCAGACTCTACCGGAAAAACACCTCTCATGATGGCTGC

AGAAAACGGACAAACCAATACAGTTG AGATGCTGGTTAGCAGTGCTAGTGCAGATCTGACATTACAAGATAAGAGTAAAAACACCGCCCTTCATTTGGC

TTGTGGCAAG GGTCATGAAACTAGTGCCTTGTTAATTCTGGAAAAGATAACAGATAGAAACCTCATCAATGCAACCAACGCAGCCTTGCAAAC ACCTC

TGCATGTTGCTGCCCGAAATGGGCTCACGATGGTTGTTCAAGAGCTCCTGGGGAAAGGAGCCAGTGTGCTTGCTGTTGATGAGAATG GCTACACCCCAG

CTTTGGCCTGTGCTCCCAATAAGGATGTGGCTGACTGCCTGGCTCTCATTTTGGCCACCATGATGCCTGTCTCGTCAAGTAGCCCATTGACATCCCTGAC

ATTCAATGCCATTAACCGTTATACCAACACCTCAAAAACAGTTAGCTTTGAAGCCTTGCCTATCATGAGGAATGAAGCCAGCTCCTACTGCAGTTTTAAC

AACATTGGTGGCGAGCAGGAGTACTTGTACACCGACGTGGATGAGCTCAACGACTCTGACTCCGAGACCTACTGAAAGGCCGAGTGAGCTGCAGCTCTAA

GGAAGTTCTGACACTGAAACTTCAAATCGGGCTTTTTCGGGAAAAAGGCACTTTCTTATCATACACAGATTCAACCTGAAGAAAGATCATGCAGTGAACG

AATGGAAGAAACATGATGACATTAGGAAGAAGAGTCTTAAAGGCAAGTTTTGCAAAAGGAACTTCTAGAATCTTAATAATGACTTGACCAGTGGAAAACA

CAGTGATGTCGATTGCTTTGTGGGATCGTTTAATTGGCTTTGCAGTGCCAGAAATTGGGACACTGCTCCCTGACCTGCTTACATGGGCAACACTGCTGTA

AAGAAAGAGATCAAAACACTAGATTAAATTTTACCCATAAAATTACAGCTAAATTTTAATGCAATAAAAGTTTGGTATAATAGGCATTATGTACACATCA

AATTGCCAAGGACCAAATAACATACAGATTTTTTTATTAGAACTCCATTTTGTGGAAACGGAAATAGATGAAATGAGAAGTCGTCTAAAGCAAACTTCAG

TGCTTCTGAAAGTGAGGCCAGATTCGGTTTGGTGTTGGTTTTTATAAGAAAGCATCTACTGTATTAAGCCATGAGAGGAAGCAGATGTATTTTTACATTT

TTTAATATAAAAGTTTTTAAATTCCACTTTTTATAGACTTCAGAACCAGTTAACTGGGTGCAGCGTGGTTGAAAGTACTAGAGACAGACGCAGATGAAGT

CAGGGCTGTTGCCCACGATTGAGTGGTTTGCTTTTAAATTGAATTGTTTTTGTTTAAGGAATTCCATAGAGGAAATTTTTAATGAATTTAAAAAACAGAC

TATTTCACCTCTTGTAATGCAGCGGTCCTGGAGAAGGGACATCTGAGCCTCTCTGTGCGCGGCACACCTGCATCACGTTAGTTACTTTGGGACCTCTACC

TTTTTTGGCTGGAGGAATTCTATTGTCATTTATTTTAATCTTTGAACTTTAAAAACAAGAATCAAAATTTTAAAAAGTTTGAAGACTCTTGTTATGAAAC

ATTGTCGAAAGCTGGTTGTGAATTCTATACAAACTGGGATTGTAAATGTTTTATGTAAAAGAAAATACTTAAAAATGTACCTGCTTCCTCTCCTGCGTCC

TCACAGCACTGGAAGGTTCTTGAATGCATCCTTTCCTTTGTTGTTGTTGTTGTTGTTGTAGTCGTTTGTTGTTTTAAGACAGGGCTCTCTATGTGTAGCC

CTGGCTGTACTAGAGTTTGCTTTGTAGACCAGGCTGGCCTCGATCTCACAGAGATTCACCTGTCTCAGCTTCCTAAGTGCTGGGATTAAAGGTGTGCACC

ACCACTGCCTGGCTTCAGATGTTTTCTTTATAAAAATCAACATCAAACCATTTGGCTTCCTTCTCAGAAGCATTGGAGTTTGCTTTAGATGATGACTCAT

AACATAAACAGAATCAGGTCATTTGGAAGGCATTTCTGTACTGGGCAAGATTTAAAATACTTCAGGCTTTAGGTCCTCCTGAGATCTAGAGTAGCGGGTG

TGCAGCTTCTTACTGTCAGAGCTTGCCTGCCAAATTGAAGACTGCCTTTCAGGTAACAGAGAAGAGGCTGACAGTAGGCTAATTTTAAATTACACTTTTC

TGTGGTTCTTTTATTGTAACTGTCACTTTCCCAGTAACAATGATTTTACATTGGGGGGAGGGGTCTTACTAGAGCTGGGTAAAGTTCCATACATTGCAAC

AAAATGATACCCAATTCCATCTTACCCTTTTTGTATTGTGAAACTGGAACTTTATGACATTGTAAATTATCAGCTGGTTTTTCTGAATATAAAGTGTGAA

AACACAGAACAGTATTTTGATCTATTTGATAATTTTGTGGGTTTTTTGAAGAATTAATGAGCATGTACATAGAAATAGTGACTGCTTGAATCCTGTATTT

ACTTGCACTCTTTCAGTACATCAAGATTCCTGTATATTTTAGAGTATAATAAAACACAGACGTGAGCTGTATTTAATGAA
Translation
MAFLKLRDQ - UNI2886 - PSLVQAIFNGDPDEVRALIFKKEDVNFQ - UNI4402 - DNEKRTPLHAAAYLGDAEIIELLILSG GARVNAKDS

KWLTPLHRAVASCSE EAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGE MVKLLLSRGANINAFD

KKDRRAIHWAAYMG GHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVD MNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQ

KNEKGFTPLHFAAASTHGALCLELLVGNGADVNMK SKDGKTPLHMTALHGRFSRSQTIIQSG GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGAD

TAK KRGIHGMFPLHLAALSGFSDCCRKLLSSG GFDIDTPDDFGRTCLHAAAAGG GNLECLNLLLNTGADFNKKDKFGR RSPLHYAAANCNYQCLFA

LVGSGASVNDLDERGCTPLHYAATSDTDGK KCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQL IASETPLDV LMETSGTDMLSDSDNRATIS

PLHLA AYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAA ATNGHSECLRLLIGNAEPQNAVDIQ

DGNGQ QTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRG AVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVD

ANPAVVDNHGYTALHWACYNG GHETCVELLLEQDVFQKIDGNAFSPLHCAV VINDNEGAAEMLIDSLGASIVNATDSKGR RTPLHAAAFTDHVECLQ

LLLSQNAQVNSADSTGKTPLMMAAENGQTNTVE EMLVSSASADLTLQDKSKNTALHLACGK GHETSALLILEKITDRNLINATNAALQT TPLHVAAR

NGLTMVVQELLGKGASVLAVDENG GYTPALACAPNKDVADCLALILATMMPVSSSSPLTSLTFNAINRYTNTSKTVSFEALPIMRNEASSYCSFNNIGG

EQEYLYTDVDELNDSDSETY

For any suggestions or comments, please send an email to unitrap@crg.es