Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014602 (Kif1a)
Chromosomal location
Chr 1: 94914858 - 94998430 (-)
Description
kinesin family member 1A Gene [Source:MGI Symbol;Acc:MGI:108391]
RefSeq_peptide
NP_032466.2 NP_001103785.1 
UniGene
Mm.276408 
MGI
MGI:108391 
Uniprot/SWISSPROT
P33173 
Uniprot/SPTREMBL
Q5DTN3 Q05BI6 Q05BP4 Q3UH16 Q3UUN4 Q6P5H4 Q6TA13 
Human Ortholog
ENSG00000130294 (KIF1A)
Omim not available
UniTrap UNI21026
Vector Insertion
Chr 1: 94979058 - 94998339
Public Clones not available
Private Clones OST345547 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112958
Sequence
GGAGCAGGCAGTAAGAAGCATCAGTTCCAGGATCGGGGACCCTCCCCGGTGCCAGTGCCCATGCACGGCTATCCCCAGTGACGCCTGAGAG - UNI210

26 - GTGACTCTGTCCTCTCTGGGGCAACTGCAGCTGCTGAACTACCAACCAACTCCACAGAAATGGCCGGGGCCTCTGTGAAGGTGGCGGTGCGTGTC

CGCCCCTTCAACTCCCGGGAAATGAGCCGAGACTCCAAGTGCATCATTCAGATGTCTGGAAGCACCACCA CTATTGTCAACCCCAAACAGCCCAAGGAG

ACACCCAAGAGCTTCAGCTTTGATTACTCCTACTGGTCACATACCTCG CCGGAGGACATCAACTATGCCTCTCAGAAGCAGGTCTACAGGGACATTGGG

GAAGAGATGCTACAGCATGCCTTTGAGGGCTACAATGTGTGCATCTTTGCCTATGGGCAGACGGGGGCCGGCAAGTCCTACACCATGATGGGGAAACAGG

AGAAGGACCAGCAAGGCATCATTCCACAG CTCTGCGAAGACCTCTTCTCTCGAATCAACGACACCACCAACGACAACATGTCCTACTCTGTGGAG GTC

AGCTACATGGAGATTTACTGTGAGCGAGTCCGTGACCTCCTGAACCCCAAGAACAAAGGCAACCTGCGTGTGAGGGAGCACCCTCTGCTGGGGCCTTATG

TGGAGGACCTCTCCAAGCTGGCTGTAACCTCCTACAATGACATCCAGGACCTCATGGACTCAGGGAACAAGGCCAG GACTGTGGCGGCCACAAACATGA

ATGAGACCAGCAGCCGTTCTCACGCAGTCTTCAACATCATCTTTACCCAGAAGCGCCATGATGCAGAGACCAACATCACCACAGAGAAA GTGAGCAAAA

TCAGCCTGGTGGACCTGGCAGGCAGTGAACGAGCCGACTCCACAGGAGCCAAGGGCACGCGACTCAAG GAGGGGGCCAACATCAACAAGTCTTTGACCA

CCCTGGGAAAGGTCATCTCTGCTCTGGCTGAAATG GACTCTGGACCCAACAAG AACAAGAAAAAGAAGAAGACAGATTTCATCCCTTACCGAGACTCC

GTATTGACATGGCTTCTCCGGGAAAACCTCG GTGGCAACTCAAGGACAGCCATGGTGGCAGCCCTGAGCCCTGCGGACATCAACTATGATGAGACCCTC

AGCACACTGAG ATATGCAGATCGGGCCAAACAAATCCGCTGCAATGCCATCATCAATGAAGACCCCAACAACAAGCTGATTAGAGAACTGAAGGATGAG

GTGACCAGGCTGAGAGACCTGCTGTATGCCCAAGGTCTTGGCGATATCACTGACA CCAACACTGTGCCCGGAGGACCCAAAT TGACCAATGCCCTGGT

GGGCATGAGCCCCTCATCTTCACTCTCAGCCCTGTCCAGCCGTGCAGCCTCTGTGTCCAGTCTCCATGAGCGCATCTTGTTTGCTCCAGGCAGCGAGGAG

GCTATTGAAAGGCTGAAG GAAACAGAGAAGATCATTGCTGAACTCAATGAGACCTGGGAGGAGAAGCTGCGGCGGACAGAAGCCATCCGGATGGAGAG 

GGAAGCCTTGCTGGCTGAGATGGGTGTGGCCATGAGGGAAGATGGTGGTACCTTGGGTGTGTTTTCTCCCAAAAAG ACTCCTCATCTTGTCAACCTGAA

TGAGGACCCTTTGATGTCCGAATGCCTCCTTTACTACATCAAAGATGGCGTCACCAG AGTGGGCAGAGAAGATGCAGAGAGGCGGCAAGACATTGTCCT

GAGTGGACACTTCATCAAAGAGGAGCACTGCATCTTCCGGAGTGACTCCCGAGGAGGCGGAGAAG CTGTGGTGACCCTGGAGCCCTGTGAAGGAGCAGA

CACATATGTCAACGGCAAGAAAGTCACTGAGCCCAGCATCCTACGGTCAG GAAACCGCATCATCATGGGAAAAAGCCACGTGTTCCGGTTTAACCACCC

TGAGCAGGCCCGTCAGGAGCGTGAGCGAACACCTTGTGCAGAGACACCTGCTGAGCCAGTGGACTGGGCCTTTGCCCAGCGGGAACTGCTGGAGAAGCAA

GGCATTGACATGAAGCAG GCCATCTCAG CTGATGAAGAGGCTCCGGATTATGGCTCGGGTGTCCGTCAGTCAGGAACTGCTAAAATCTCCTTTGATGA

CCAGCATTTTGAAAAG TTCCAATCTGAGTCCTGCCCTGTGGTGGGGATGTCCCGCTCAGGAACTTCCCAAGAGGAGCTGCGCATTGTAGAAGGCCAGGG

TCAGGGGGCTGATGCTGGGCCTTCAGCTGATGAAGTTAACAACAACACCTGTTCAG CTGTGCCTCCTGAAGGCCTCATGGATAGCCCAGAGAAGGCTGC

CCTGGATGGGCCTCTGGACACAGCCCTGGACCACCTCCGTCTAGGCAGTACCTTCACCTTCCGGGTGACAGTCCTGCAGGCGTCCAGTATCTCTGCTGAA

TACGCTGACATCTTCTGCCAGTTCAA CTTTATCCACCGCCACGATGAGGCCTTCTCCACTGAACCCCTGAAGAACACTGGCAGAGGACCCCCTCTTGGC

TTCTACCATGTCCAAAAT ATTGCGGTAGAGGTGACCAAGTCCTTCATCGAATACATCAAGAGCCAGCCCATTGTGTTCGAGGTCTTTGGGCACTACCAG

CAGCACCCGTTCCCACCTCTTTGCAAGGATGTCCTCAG CCCCCTGAGACCCTCACGTCGCCACTTCCCCAGGGTCATGCCGTTATCCAAGCCAG TGCC

CGCCACTAAGCTCAGCACGATGACACGGCCTTCCCCAGGTCCCTGCCATTGCAAGTATGACCTGCTGGTCTACTTCGAGATCTGCGAGCTGGAAGCCAAT

GGCGA TTACATCCCTGCTGTGGTGGACCACCGTGGTGGCATGCCGTGCATGGGGACTTTCCTTCTCCATCAG GGCATCCAGAGACGGATAACTGTGAC

ACTGTTACATGAGACAGGAAGCCACATCCGCTGGAAGGAAGTGCGCGAGCTAGTTGTGG GTCGCATCCGAAACACCCCAGAAACTGACGAAGCTCTGAT

TGACCCCAACATCTTGTCCCTCAACATCCTCTCATCAGGATACGTCCATCCAGCCCAGGATGACCG GACCTTCTACCAGTTTGAAGCAGCCTGGGACAG

TTCCATGCATAACTCTCTCCTGCTGAATCGTGTCACCCCTTACCGGGAGAAAATCTACATGACGCTCTCTGCCTACATTGAG ATGGAGAACTGTACCCA

GCCAGCTGTCATCACCAAGGACTTCTGCATGGTTTTCTACTCTCGGGACGCCAAGCTACCCGCCTCACGCTCCATTCGCAACCTGTTTGGCAGTGGCAGC

CTGCGGGCCACAGAAGG CAACCGTGTGACTGGTGTGTATGAGCTCAGCCTTTGCCACGTGGCCGACGCAGGCAGCCCAG GGATGCAGCGTCGGCGCCG

GCGGGTGCTGGACACATCAGTAGCCTATGTCCGGGGTGAGGAGAACCTGGCTGGCTGGAGGCCCCGAAGTGACAGCCTGATCCTAGATCACCAGTGGGAA

CTGGAGAAACTGAGCCTCTTACAGGAG GTGGAAAAGACCAGGCACTACCTGCTCCTTCGGGAGAAGCTGGAGACGACCCAGCGCCCTGGCCCTGAGGTG

CTGTCCCCAGCCTCCAGTGAGGACTCTGAGTCCCGTAGTTCTTCAGGTGCCTCTTCCCCATTGTCAGCCGAGGGTCAGCCGTCACCTCTGGAGGCTCCCA

ACGAGAGGCAGAGGGAGCTGGCTGTCAAG TGCTTACGACTCCTCATGCACACATTCAACAGGGAATACACCCACAGCCACGTCTGTATCAGCGCCAGCG

AGAGCAAG CTCTCTGAGATGTCTGTCACCCTGATGCGGGACCCATCCATGTCCCCTCTGGGTGCTGCTACACTCACTCCCTCCTCCACTTGCCCCTCTC

TGATCGAAGGACGATACGGTGCCACTGACGTGAG GACCCCCCAGCCCTGCTCCCGGCCCGCCAGCCCAGAGCCCGAGCTCCTGCCAGAACTTGACTCTA

AGAAGACTCCCTCCCCTGTTCGGGCAACAGAGACAGAGAAGGAGCCCCAGCGACTGCTGGTCCCTGACATCCAAGAGATCCGAGTCAG CCCAATCGTCT

CCAAGAAGGGATACCTGCATTTCCTGGAGCCACACACGGCTGGCTGGGCCAAGCGCTTTGTGGTGGTGAGGCGTCCCTACGCCTACATGTACAACAGTGA

CAAGGACACGGTGGAGAGATTTGTGCTCAACCTCTCCACTGCGCAGGTGGAGTACAGCGAGGACCAGCAGGCCATGCTCAAG ACACCCAACACATTCGC

TGTGTGCACGGAGCACCGAGGCATCCTGCTGCAGGCCAACAGTGACAAGGACATGCACGACTGGCTGTATGCCTTCAACCCGCTCCTGGCTGGGACCATC

CG GTCCAAGCTCTCTCGAAGGAGATCTGCGCAGATGCGGGTCTGAGTTGAAAGCCTTCCGGACTTCCAGTGGCCCAGACCACTCCCCTGTCCTTACCAT

CTGTTCTGTCATCTGCCACTCAGCCCTTCCCCCCTACCCACCACCAGGGGACACCTGTGCTGGGCCCAGCAACCCTACCTCTGGAGGGAGGCCTATACCA

CATGACGAATTGTGCTCCCCCC
Translation
 - UNI21026 -        M DSGPNK NKKKKKTDFIPYRDSVLTWLLRENLG GGNSRTAMVAALSPADINYDETLSTLR RYADRAKQIRCNAII

NEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDT TNTVPGGPKL LTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLK ETEKIIAE

LNETWEEKLRRTEAIRMER REALLAEMGVAMREDGGTLGVFSPKK TPHLVNLNEDPLMSECLLYYIKDGVTR RVGREDAERRQDIVLSGHFIKEEHC

IFRSDSRGGGEA AVVTLEPCEGADTYVNGKKVTEPSILRSG GNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQ 

AISA ADEEAPDYGSGVRQSGTAKISFDDQHFEK FQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNNNTCSA AVPPEGLMDSPEKAALD

GPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFN NFIHRHDEAFSTEPLKNTGRGPPLGFYHVQN IAVEVTKSFIEYIKSQPIVFEVFGHYQ

QHPFPPLCKDVLS SPLRPSRRHFPRVMPLSKPV VPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGD DYIPAVVDHRGGMPCMGTFLLHQ GIQ

RRITVTLLHETGSHIRWKEVRELVVG GRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDR RTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSA

YIE MENCTQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRATEG GNRVTGVYELSLCHVADAGSPG GMQRRRRRVLDTSVAYVRGEENLAGWR

PRSDSLILDHQWELEKLSLLQE VEKTRHYLLLREKLETTQRPGPEVLSPASSEDSESRSSSGASSPLSAEGQPSPLEAPNERQRELAVK CLRLLMHTF

NREYTHSHVCISASESK LSEMSVTLMRDPSMSPLGAATLTPSSTCPSLIEGRYGATDVR RTPQPCSRPASPEPELLPELDSKKTPSPVRATETEKEPQ

RLLVPDIQEIRVS SPIVSKKGYLHFLEPHTAGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSEDQQAMLK TPNTFAVCTEHRGILLQANS

DKDMHDWLYAFNPLLAGTIR RSKLSRRRSAQMRV
Transcript ENSMUST00000086819
Sequence
GGAGCAGGCAGTAAGAAGCATCAGTTCCAGGATCGGGGACCCTCCCCGGTGCCAGTGCCCATGCACGGCTATCCCCAGTGACGCCTGAGAG - UNI210

26 - GTGACTCTGTCCTCTCTGGGGCAACTGCAGCTGCTGAACTACCAACCAACTCCACAGAAATGGCCGGGGCCTCTGTGAAGGTGGCGGTGCGTGTC

CGCCCCTTCAACTCCCGGGAAATGAGCCGAGACTCCAAGTGCATCATTCAGATGTCTGGAAGCACCACCA CTATTGTCAACCCCAAACAGCCCAAGGAG

ACACCCAAGAGCTTCAGCTTTGATTACTCCTACTGGTCACATACCTCG CCGGAGGACATCAACTATGCCTCTCAGAAGCAGGTCTACAGGGACATTGGG

GAAGAGATGCTACAGCATGCCTTTGAGGGCTACAATGTGTGCATCTTTGCCTATGGGCAGACGGGGGCCGGCAAGTCCTACACCATGATGGGGAAACAGG

AGAAGGACCAGCAAGGCATCATTCCACAG CTCTGCGAAGACCTCTTCTCTCGAATCAACGACACCACCAACGACAACATGTCCTACTCTGTGGAG GTC

AGCTACATGGAGATTTACTGTGAGCGAGTCCGTGACCTCCTGAACCCCAAGAACAAAGGCAACCTGCGTGTGAGGGAGCACCCTCTGCTGGGGCCTTATG

TGGAGGACCTCTCCAAGCTGGCTGTAACCTCCTACAATGACATCCAGGACCTCATGGACTCAGGGAACAAGGCCAG GACTGTGGCGGCCACAAACATGA

ATGAGACCAGCAGCCGTTCTCACGCAGTCTTCAACATCATCTTTACCCAGAAGCGCCATGATGCAGAGACCAACATCACCACAGAGAAA GTGAGCAAAA

TCAGCCTGGTGGACCTGGCAGGCAGTGAACGAGCCGACTCCACAGGAGCCAAGGGCACGCGACTCAAG GAGGGGGCCAACATCAACAAGTCTTTGACCA

CCCTGGGAAAGGTCATCTCTGCTCTGGCTGAAATG GACTCTGGACCCAACAAG AACAAGAAAAAGAAGAAGACAGATTTCATCCCTTACCGAGACTCC

GTATTGACATGGCTTCTCCGGGAAAACCTCG GTGGCAACTCAAGGACAGCCATGGTGGCAGCCCTGAGCCCTGCGGACATCAACTATGATGAGACCCTC

AGCACACTGAG ATATGCAGATCGGGCCAAACAAATCCGCTGCAATGCCATCATCAATGAAGACCCCAACAACAAGCTGATTAGAGAACTGAAGGATGAG

GTGACCAGGCTGAGAGACCTGCTGTATGCCCAAGGTCTTGGCGATATCACTGACA TGACCAATGCCCTGGTGGGCATGAGCCCCTCATCTTCACTCTCA

GCCCTGTCCAGCCGTGCAGCCTCTGTGTCCAGTCTCCATGAGCGCATCTTGTTTGCTCCAGGCAGCGAGGAGGCTATTGAAAGGCTGAAG GAAACAGAG

AAGATCATTGCTGAACTCAATGAGACCTGGGAGGAGAAGCTGCGGCGGACAGAAGCCATCCGGATGGAGAG GGAAGCCTTGCTGGCTGAGATGGGTGTG

GCCATGAGGGAAGATGGTGGTACCTTGGGTGTGTTTTCTCCCAAAAAG ACTCCTCATCTTGTCAACCTGAATGAGGACCCTTTGATGTCCGAATGCCTC

CTTTACTACATCAAAGATGGCGTCACCAG AGTGGGCAGAGAAGATGCAGAGAGGCGGCAAGACATTGTCCTGAGTGGACACTTCATCAAAGAGGAGCAC

TGCATCTTCCGGAGTGACTCCCGAGGAGGCGGAGAAG CTGTGGTGACCCTGGAGCCCTGTGAAGGAGCAGACACATATGTCAACGGCAAGAAAGTCACT

GAGCCCAGCATCCTACGGTCAG GAAACCGCATCATCATGGGAAAAAGCCACGTGTTCCGGTTTAACCACCCTGAGCAGGCCCGTCAGGAGCGTGAGCGA

ACACCTTGTGCAGAGACACCTGCTGAGCCAGTGGACTGGGCCTTTGCCCAGCGGGAACTGCTGGAGAAGCAAGGCATTGACATGAAGCAGGAGATGGAGC

AGAG GCTCCAGGAGTTGGAGGACCAGTACCGGAGGGAGCGGGAGGAGGCCACATACCTTCTGGAGCAGCAGAGGCTG GACTATGAGAGTAAGCTGGAG

GCCCTACAGAAACAGATGGACTCCAGGTACTACCCAGAGGTGAACGAGGAGGAAGAAGAGCCAGAGGATGAAG TCCAATGGACAGAACGAGAATGTGAG

CTGGCATTGTGGGCCTTCCGGAAGTGGAAGTGGTACCAGTTTACTTCTCTGCGGGACCTGCTGTGGGGCAATGCCATCTTCCTGAAGGAGGCCAACGCCA

TCAGTGTGGAGCTAAAGAAGAAG GTCCAGTTCCAGTTTGTCCTCCTCACGGACACCCTGTACTCCCCACTGCCGCCAGACCTACTGCCCCCAGAAGCCG

CCAAAGACCGAGAGACACGACCCTTCCCCAGGACCATTGTGGCAGTGGAGGTCCAGGACCAGAAGAATGGGGCCACCCACTACTGGACACTGGAGAAACT

CAG GCAACGCCTGGACCTGATGCGGGAAATGTACGACAGGGCTGCAGAGGTTCCCTCCAGCGTCGTTGAGGACTGTGACAACGTGGTGACCGGCGGGGA

CCCCTTCTATGACCGCTTCCCCTGGTTCCGACTGGTGGGCAG GGCCTTCGTATACCTGAGCAACCTGCTGTACCCTGTGCCCCTGGTGCACCGAGTGGC

AATCGTCAGCGAAAAGGGAGAGGTGAAAGGCTTCCTCCGTGTGGCGGTGCAGGCCATCTCAG CTGATGAAGAGGCTCCGGATTATGGCTCGGGTGTCCG

TCAGTCAGGAACTGCTAAAATCTCCTTTGATGACCAGCATTTTGAAAAG TTCCAATCTGAGTCCTGCCCTGTGGTGGGGATGTCCCGCTCAGGAACTTC

CCAAGAGGAGCTGCGCATTGTAGAAGGCCAGGGTCAGGGGGCTGATGCTGGGCCTTCAGCTGATGAAGTTAACAACAACACCTGTTCAG CTGTGCCTCC

TGAAGGCCTCATGGATAGCCCAGAGAAGGCTGCCCTGGATGGGCCTCTGGACACAGCCCTGGACCACCTCCGTCTAGGCAGTACCTTCACCTTCCGGGTG

ACAGTCCTGCAGGCGTCCAGTATCTCTGCTGAATACGCTGACATCTTCTGCCAGTTCAA CTTTATCCACCGCCACGATGAGGCCTTCTCCACTGAACCC

CTGAAGAACACTGGCAGAGGACCCCCTCTTGGCTTCTACCATGTCCAAAAT ATTGCGGTAGAGGTGACCAAGTCCTTCATCGAATACATCAAGAGCCAG

CCCATTGTGTTCGAGGTCTTTGGGCACTACCAGCAGCACCCGTTCCCACCTCTTTGCAAGGATGTCCTCAG CCCCCTGAGACCCTCACGTCGCCACTTC

CCCAGGGTCATGCCGTTATCCAAGCCAG TGCCCGCCACTAAGCTCAGCACGATGACACGGCCTTCCCCAGGTCCCTGCCATTGCAAGTATGACCTGCTG

GTCTACTTCGAGATCTGCGAGCTGGAAGCCAATGGCGA TTACATCCCTGCTGTGGTGGACCACCGTGGTGGCATGCCGTGCATGGGGACTTTCCTTCTC

CATCAG GGCATCCAGAGACGGATAACTGTGACACTGTTACATGAGACAGGAAGCCACATCCGCTGGAAGGAAGTGCGCGAGCTAGTTGTGG GTCGCAT

CCGAAACACCCCAGAAACTGACGAAGCTCTGATTGACCCCAACATCTTGTCCCTCAACATCCTCTCATCAGGATACGTCCATCCAGCCCAGGATGACCG 

CGTTTCCTTCGGAAATGACACTAG GACCTTCTACCAGTTTGAAGCAGCCTGGGACAGTTCCATGCATAACTCTCTCCTGCTGAATCGTGTCACCCCTTA

CCGGGAGAAAATCTACATGACGCTCTCTGCCTACATTGAG ATGGAGAACTGTACCCAGCCAGCTGTCATCACCAAGGACTTCTGCATGGTTTTCTACTC

TCGGGACGCCAAGCTACCCGCCTCACGCTCCATTCGCAACCTGTTTGGCAGTGGCAGCCTGCGGGCCACAGAAGG CAACCGTGTGACTGGTGTGTATGA

GCTCAGCCTTTGCCACGTGGCCGACGCAGGCAGCCCAG GGATGCAGCGTCGGCGCCGGCGGGTGCTGGACACATCAGTAGCCTATGTCCGGGGTGAGGA

GAACCTGGCTGGCTGGAGGCCCCGAAGTGACAGCCTGATCCTAGATCACCAGTGGGAACTGGAGAAACTGAGCCTCTTACAGGAG GTGGAAAAGACCAG

GCACTACCTGCTCCTTCGGGAGAAGCTGGAGACGACCCAGCGCCCTGGCCCTGAGGTGCTGTCCCCAGCCTCCAGTGAGGACTCTGAGTCCCGTAGTTCT

TCAGGTGCCTCTTCCCCATTGTCAGCCGAGGGTCAGCCGTCACCTCTGGAGGCTCCCAACGAGAGGCAGAGGGAGCTGGCTGTCAAG TGCTTACGACTC

CTCATGCACACATTCAACAGGGAATACACCCACAGCCACGTCTGTATCAGCGCCAGCGAGAGCAAG CTCTCTGAGATGTCTGTCACCCTGATGCGGGAC

CCATCCATGTCCCCTCTGGGTGCTGCTACACTCACTCCCTCCTCCACTTGCCCCTCTCTGATCGAAGGACGATACGGTGCCACTGACGTGAG GACCCCC

CAGCCCTGCTCCCGGCCCGCCAGCCCAGAGCCCGAGCTCCTGCCAGAACTTGACTCTAAGAAGACTCCCTCCCCTGTTCGGGCAACAGAGACAGAGAAGG

AGCCCCAGCGACTGCTGGTCCCTGACATCCAAGAGATCCGAGTCAG CCCAATCGTCTCCAAGAAGGGATACCTGCATTTCCTGGAGCCACACACGGCTG

GCTGGGCCAAGCGCTTTGTGGTGGTGAGGCGTCCCTACGCCTACATGTACAACAGTGACAAGGACACGGTGGAGAGATTTGTGCTCAACCTCTCCACTGC

GCAGGTGGAGTACAGCGAGGACCAGCAGGCCATGCTCAAG ACACCCAACACATTCGCTGTGTGCACGGAGCACCGAGGCATCCTGCTGCAGGCCAACAG

TGACAAGGACATGCACGACTGGCTGTATGCCTTCAACCCGCTCCTGGCTGGGACCATCCG GTCCAAGCTCTCTCGAAGGAGATCTGCGCAGATGCGGGT

CTGAGTTGAAAGCCTTCCGGACTTCCAGTGGCCCAGACCACTCCCCTGTCCTTACCATCTGTTCTGTCATCTGCCACTCAGCCCTTCCCCCCTACCCACC

ACCAGGGGACACCTGTGCTGGGCCCAGCAACCCTACCTCTGGAGGGAGGCCTATACCACATGACGAATTGTGCTCCCCCC
Translation
 - UNI21026 - MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTT TIVNPKQPKETPKSFSFDYSYWSHTS PEDINYASQKQVYRDIGEEMLQ

HAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQ LCEDLFSRINDTTNDNMSYSVE VSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDL

SKLAVTSYNDIQDLMDSGNKAR RTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEK VSKISLVDLAGSERADSTGAKGTRLK EGANINKSLTT

LGKVISALAEM DSGPNK NKKKKKTDFIPYRDSVLTWLLRENLG GGNSRTAMVAALSPADINYDETLSTLR RYADRAKQIRCNAIINEDPNNKLIRE

LKDEVTRLRDLLYAQGLGDITDM MTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLK ETEKIIAELNETWEEKLRRTEAIRMER RE

ALLAEMGVAMREDGGTLGVFSPKK TPHLVNLNEDPLMSECLLYYIKDGVTR RVGREDAERRQDIVLSGHFIKEEHCIFRSDSRGGGEA AVVTLEPCE

GADTYVNGKKVTEPSILRSG GNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQR RLQELEDQYRREREEAT

YLLEQQRL DYESKLEALQKQMDSRYYPEVNEEEEEPEDEV VQWTERECELALWAFRKWKWYQFTSLRDLLWGNAIFLKEANAISVELKKK VQFQFVL

LTDTLYSPLPPDLLPPEAAKDRETRPFPRTIVAVEVQDQKNGATHYWTLEKLR RQRLDLMREMYDRAAEVPSSVVEDCDNVVTGGDPFYDRFPWFRLVG

R RAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISA ADEEAPDYGSGVRQSGTAKISFDDQHFEK FQSESCPVVGMSRSGTSQEELRIVEG

QGQGADAGPSADEVNNNTCSA AVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFN NFIHRHDEAFSTEPLKNTGR

GPPLGFYHVQN IAVEVTKSFIEYIKSQPIVFEVFGHYQQHPFPPLCKDVLS SPLRPSRRHFPRVMPLSKPV VPATKLSTMTRPSPGPCHCKYDLLVY

FEICELEANGD DYIPAVVDHRGGMPCMGTFLLHQ GIQRRITVTLLHETGSHIRWKEVRELVVG GRIRNTPETDEALIDPNILSLNILSSGYVHPAQD

DR RVSFGNDTR RTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIE MENCTQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRATEG G

NRVTGVYELSLCHVADAGSPG GMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQE VEKTRHYLLLREKLETTQRPGPEVLSPA

SSEDSESRSSSGASSPLSAEGQPSPLEAPNERQRELAVK CLRLLMHTFNREYTHSHVCISASESK LSEMSVTLMRDPSMSPLGAATLTPSSTCPSLIE

GRYGATDVR RTPQPCSRPASPEPELLPELDSKKTPSPVRATETEKEPQRLLVPDIQEIRVS SPIVSKKGYLHFLEPHTAGWAKRFVVVRRPYAYMYNS

DKDTVERFVLNLSTAQVEYSEDQQAMLK TPNTFAVCTEHRGILLQANSDKDMHDWLYAFNPLLAGTIR RSKLSRRRSAQMRV

For any suggestions or comments, please send an email to unitrap@crg.es