Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014668 (Chfr)
Chromosomal location
Chr 5: 110564879 - 110600991 (+)
Description
checkpoint with forkhead and ring finger domains Gene [Source:MGI Symbol;Acc:MGI:2444898]
RefSeq_dna
NM_172717 
RefSeq_peptide
NP_766305.2 
UniGene
Mm.400973 Mm.30264 
MGI
MGI:2444898 
Uniprot/SWISSPROT
Q810L3 
Uniprot/SPTREMBL
Q3UGJ9 Q3U233 Q3V0G8 Q3TFD8 Q3U4U9 
Human Ortholog
ENSG00000072609 (CHFR)
Omim not available
UniTrap UNI30461
Vector Insertion
Chr 5: 110569473 - 110572569
Public Clones CMHD-GT_330E9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33996
Vector Insertion
Chr 5: 110598234 - 110599880
Public Clones IST11172G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100932
Sequence
GGGGTACCCGAGATGTCTGTTGACAGCGGTGGCGGCGACTGTAAGGCCGGTTCCGGGATCCGCGCAGGGCGTGGG ATGTGAGTCCTATGGAGCTACACG

GGGAAGAGCAGCCGCCGCCGCCGCAGGAACCCTGGGGGAGGCTTCTTCGTCTAGGCGCAGAGGAGGACGAACCCCAGATCCTTCTTTGGAAACGCGAGTG

GACCATCGGAAGGAGGAGAG GCTGTGACCTCTCTTTCCCCAGCAATAAACTGGTCTCTGGAGATCACTGTAAACTTACAGTGGATGAAATATCTGGTGA

GGTGACACTGGAAGACACCAG - UNI30461 - CACCAATGGAACAGTGATCAATAAGCTGCAAGTTGTTAAGAAGCAGACTTACCCTTTACAGAGCG

GGGATATCATCTATTTGGTGTACAGGAAGAATGAGCCAGAACACA ATGTGGCATACCTCTATGAATCTTTAAGTGGCAAACAGAGCTTAACTCAAGACT

CCCTTG GACCTGGGAACACAAGCATCTCCCCAAAAGGACGCAGTTCACTTGTTGCAAATGGCGAACTCTCTAGCCTTTCTCCAGTTTTCCAAGACAAAG

AAGCATCCTTTTCTTTGCTGGAAAGTAAAGACCATGAGGAATTGGAGCCTGCCAAAAAAAAGATGAAAGGAG ATGGGGAACTTGACACGAACCTCCAGT

TATTAGTTTCAGGCCAGCGTGGAAATGCCCAAACCTCAAGTGAAGATGTCAAAGATGCCTCTGTGAAGCCAGACAAGATGGAGGAGACACTAACCTGTAT

CATCTGCCAGGACCTTCTGCACGATTGTGTGAG TTTGCAGCCTTGTATGCACACATTTTGTGCGGCTTGCTACTCTGGTTGGATGGAGCGTTCATCTCT

GTGCCCTACCTGCCGATGTCCAGTGGAGCGGATTTGCAAAAACCACATCCTGAACAACCTAGTGGAAGCATACCTTATCCAGCACCCAG ATAAAAGTCG

CAGTGAAGAAGATGTGAGAAGTATGGATGCAAGGAATAAAATCACTCAAGATATGCTGCAACCCAAAGTCAGGAGGTCTTTCTCTGATGAAGAGGGGAGT

TCAGAGGACCTGCTAGAGCTGTCTGATGTCGACAGTGAATCCTCAGATATCAG TCAGCCATACATTGTCTGCAGACAGTGTCCTGAATACAGAAGGCAA

GCGGTGCAGTCTCTTCCTTGCCCAGTCCCAGAGAGTGAGCTGGGAGCTACACTGGCCCTTGGTGGGGAGGCACCTTCAACATCTGCCAGCTTGCCAACAG

 CAGCCCCGGATTACATGTGCCCTCTTCAAGGAAGCCATGCCATATGCACCTGCTGCTTCCAGCCTATGCCTGACCGGAGAGCTGAACGGGAGCAGGATC

CCCGCGTCGCCCCTCAGCAGT GTGCGGTGTGCCTGCAGCCCTTCTGCCACCTGTACTGGGGCTGCACGAGGACTGGCTGCTTTGGCTGCTTGGCCCCAT

TCTGTG AGCTCAACCTGGGGGACAAGTGCTTGGATGGAGTGCTGAACAATAACAATTATGAATCGGACATCCTGAAG AATTACCTGGCAACCAGGGGT

CTGACATGGAAAAGTGTGTTGACAGAGAGTCTCCTGGCTCTGCAGCGAGGTGTATTTATGCTGTCTG ATTACAGAATCACTGGAAATACTGTGCTGTGT

TACTGCTGTGGTCTGCGTAGCTTCCGAGAGCTGACCTACCAGTATCGTCAGAACATTCCTGCTTCTGAGTTGCCAG TGACTGTAACATCCCGTCCTGAC

TGCTACTGGGGCCGTAACTGTCGCACTCAGGTGAAGGCTCACCATGCAAT - UNI33996 - GAAATTCAATCACATCTGTGAGCAAACAAGGTTCAA

GAACTGAATATTGGAAGAGACACGTGAAACAGTTACAGAGCACAGGAGGCAATGTTTTTTAAAAGGCCCCATACAAACACTTGAAGGGCATTTTTACAGT

TTTCCCTACGCAGCACTGGGGGTTCTGGTCAGGCACTGGGGTGTGGATTTTCCCTTTGTGGAGCGTCATCGTCAGTGACACACACACCACGTGCCCCAGT

AACCTGGGAGGCCTCCTGGCCACACCAGCCTTCTAGTCGGTGTAAGAGGATCAGTAGACTGAGTTCTCCCTCCCTCCCACTGGACCGCTCTCCCTCCTGT

GTGCTGAGGCAGTGACAGTGCAGGTTTGTACTTTTGTATCTTTTCTACCTTGTACCTTGACTATGGTTAAAATGGGAAGCTCATAGGAAAAGTTGTCAGC

TGTGTCAGACGCATTCTCCGGAAGGAAAGGAAGCATACGTTTACAGCCTCCAGGGGTACATAGGATAGTCTCCTGTCTGGAAAGACACAGCCTTTTGTAT

ATTTTTTATTTTAATAAGTTTGGTGCTTATCTTCTAATAAGATTTAAATATTAAAAACTGTAGCACAAATACTATAATTTATAATTTACAAATTGACTAA

AATTAGGAATAGCCTCATATTTGGAAGAATGAGCATATGTTTCTGTTTATTTAAAAAAAATTATCAACTGTCCGAAACTGCTAATCCTGGGAAGGAAGTC

TTGAGTGTCCAGGTCCTCGACCCAGGGCTGGCTGAGCCCTTAGCCCTCCAGTCCCTGAGAGCAACTCCCTGCTGAAACTCCAGATGGCTCCAGACTGACA

GGGCCTTTGCTTTCCAAGCCCTCATCTGGTACATTAGGTTTGCCATGTCATCTGGAATAATACTTGAAATTTTGTTTTTAGGTTTTTTAAAACTTTTTTA

TCTTTTATTGAAATCACCTGTTATATTTGTTTGAAAACTGGTAACTTTTTGCTTCTCAGGAAAAAAATTTTCAACTGTTGTCTTGCTCTTGATACAGACT

GAGAGGCAGTACTCTGTGTTTGTGGGAGATGGTTCTTTTTTTGATTCTAATAAATGAGCTGTGTTTGTTTCTCTT
Translation
 MELHGEEQPPPPQEPWGRLLRLGAEEDEPQILLWKREWTIGRRRG GCDLSFPSNKLVSGDHCKLTVDEISGEVTLEDTS - UNI30461 - STNGT

VINKLQVVKKQTYPLQSGDIIYLVYRKNEPEHN NVAYLYESLSGKQSLTQDSLG GPGNTSISPKGRSSLVANGELSSLSPVFQDKEASFSLLESKDHE

ELEPAKKKMKGD DGELDTNLQLLVSGQRGNAQTSSEDVKDASVKPDKMEETLTCIICQDLLHDCVS SLQPCMHTFCAACYSGWMERSSLCPTCRCPVE

RICKNHILNNLVEAYLIQHPD DKSRSEEDVRSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDIS SQPYIVCRQCPEYRRQAVQSLP

CPVPESELGATLALGGEAPSTSASLPTA AAPDYMCPLQGSHAICTCCFQPMPDRRAEREQDPRVAPQQC CAVCLQPFCHLYWGCTRTGCFGCLAPFCE

 ELNLGDKCLDGVLNNNNYESDILK NYLATRGLTWKSVLTESLLALQRGVFMLSD DYRITGNTVLCYCCGLRSFRELTYQYRQNIPASELPV VTVTS

RPDCYWGRNCRTQVKAHHAM - UNI33996 - MKFNHICEQTRFKN
Transcript ENSMUST00000014812
Sequence
GGGGTACCCGAGATGTCTGTTGACAGCGGTGGCGGCGACTGTAAGGCCGGTTCCGGGATCCGCGCAGGGCGTGGG ATGTGAGTCCTATGGAGCTACACG

GGGAAGAGCAGCCGCCGCCGCCGCAGGAACCCTGGGGGAGGCTTCTTCGTCTAGGCGCAGAGGAGGACGAACCCCAGATCCTTCTTTGGAAACGCGAGTG

GACCATCGGAAGGAGGAGAG GCTGTGACCTCTCTTTCCCCAGCAATAAACTGGTCTCTGGAGATCACTGTAAACTTACAGTGGATGAAATATCTGGTGA

GGTGACACTGGAAGACACCAG - UNI30461 - CACCAATGGAACAGTGATCAATAAGCTGCAAGTTGTTAAGAAGCAGACTTACCCTTTACAGAGCG

GGGATATCATCTATTTGGTGTACAGGAAGAATGAGCCAGAACACA ATGTGGCATACCTCTATGAATCTTTAAGTGGCAAACAGAGCTTAACTCAAGACT

CCCTTG AAGCCAATAAGGAAAATATGTTCCATGTGACCAAAGATTGCTCAGGTCCAGGGCAGGGTGATGATCCCCAGGTTCCACTATTGTCACCCATGG

CTCAGACATGCTTAGAGGAACCACAGCCATCAACATCGACATCAGACCTCCTCCCCACGGCCTCTACCTCTTCTACGGAGCCAGAGCTGACCTCTGCAGG

GCAAAAGCATTCTTCTAGCTCTG GACCTGGGAACACAAGCATCTCCCCAAAAGGACGCAGTTCACTTGTTGCAAATGGCGAACTCTCTAGCCTTTCTCC

AGTTTTCCAAGACAAAGAAGCATCCTTTTCTTTGCTGGAAAGTAAAGACCATGAGGAATTGGAGCCTGCCAAAAAAAAGATGAAAGGAG ATGGGGAACT

TGACACGAACCTCCAGTTATTAGTTTCAGGCCAGCGTGGAAATGCCCAAACCTCAAGTGAAGATGTCAAAGATGCCTCTGTGAAGCCAGACAAGATGGAG

GAGACACTAACCTGTATCATCTGCCAGGACCTTCTGCACGATTGTGTGAG TTTGCAGCCTTGTATGCACACATTTTGTGCGGCTTGCTACTCTGGTTGG

ATGGAGCGTTCATCTCTGTGCCCTACCTGCCGATGTCCAGTGGAGCGGATTTGCAAAAACCACATCCTGAACAACCTAGTGGAAGCATACCTTATCCAGC

ACCCAG ATAAAAGTCGCAGTGAAGAAGATGTGAGAAGTATGGATGCAAGGAATAAAATCACTCAAGATATGCTGCAACCCAAAGTCAGGAGGTCTTTCT

CTGATGAAGAGGGGAGTTCAGAGGACCTGCTAGAGCTGTCTGATGTCGACAGTGAATCCTCAGATATCAG TCAGCCATACATTGTCTGCAGACAGTGTC

CTGAATACAGAAGGCAAGCGGTGCAGTCTCTTCCTTGCCCAGTCCCAGAGAGTGAGCTGGGAGCTACACTGGCCCTTGGTGGGGAGGCACCTTCAACATC

TGCCAGCTTGCCAACAG CCCCGGATTACATGTGCCCTCTTCAAGGAAGCCATGCCATATGCACCTGCTGCTTCCAGCCTATGCCTGACCGGAGAGCTGA

ACGGGAGCAGGATCCCCGCGTCGCCCCTCAGCAGT GTGCGGTGTGCCTGCAGCCCTTCTGCCACCTGTACTGGGGCTGCACGAGGACTGGCTGCTTTGG

CTGCTTGGCCCCATTCTGTG AGCTCAACCTGGGGGACAAGTGCTTGGATGGAGTGCTGAACAATAACAATTATGAATCGGACATCCTGAAG AATTACC

TGGCAACCAGGGGTCTGACATGGAAAAGTGTGTTGACAGAGAGTCTCCTGGCTCTGCAGCGAGGTGTATTTATGCTGTCTG ATTACAGAATCACTGGAA

ATACTGTGCTGTGTTACTGCTGTGGTCTGCGTAGCTTCCGAGAGCTGACCTACCAGTATCGTCAGAACATTCCTGCTTCTGAGTTGCCAG TGACTGTAA

CATCCCGTCCTGACTGCTACTGGGGCCGTAACTGTCGCACTCAGGTGAAGGCTCACCATGCAAT - UNI33996 - GAAATTCAATCACATCTGTGAG

CAAACAAGGTTCAAGAACTGAATATTGGAAGAGACACGTGAAACAGTTACAGAGCACAGGAGGCAATGTTTTTTAAAAGGCCCCATACAAACACTTGAAG

GGCATTTTTACAGTTTTCCCTACGCAGCACTGGGGGTTCTGGTCAGGCACTGGGGTGTGGATTTTCCCTTTGTGGAGCGTCATCGTCAGTGACACACACA

CCACGTGCCCCAGTAACCTGGGAGGCCTCCTGGCCACACCAGCCTTCTAGTCGGTGTAAGAGGATCAGTAGACTGAGTTCTCCCTCCCTCCCACTGGACC

GCTCTCCCTCCTGTGTGCTGAGGCAGTGACAGTGCAGGTTTGTACTTTTGTATCTTTTCTACCTTGTACCTTGACTATGGTTAAAATGGGAAGCTCATAG

GAAAAGTTGTCAGCTGTGTCAGACGCATTCTCCGGAAGGAAAGGAAGCATACGTTTACAGCCTCCAGGGGTACATAGGATAGTCTCCTGTCTGGAAAGAC

ACAGCCTTTTGTATATTTTTTATTTTAATAAGTTTGGTGCTTATCTTCTAATAAGATTTAAATATTAAAAACTGTAGCACAAATACTATAATTTATAATT

TACAAATTGACTAAAATTAGGAATAGCCTCATATTTGGAAGAATGAGCATATGTTTCTGTTTATTTAAAAAAAATTATCAACTGTCCGAAACTGCTAATC

CTGGGAAGGAAGTCTTGAGTGTCCAGGTCCTCGACCCAGGGCTGGCTGAGCCCTTAGCCCTCCAGTCCCTGAGAGCAACTCCCTGCTGAAACTCCAGATG

GCTCCAGACTGACAGGGCCTTTGCTTTCCAAGCCCTCATCTGGTACATTAGGTTTGCCATGTCATCTGGAATAATACTTGAAATTTTGTTTTTAGGTTTT

TTAAAACTTTTTTATCTTTTATTGAAATCACCTGTTATATTTGTTTGAAAACTGGTAACTTTTTGCTTCTCAGGAAAAAAATTTTCAACTGTTGTCTTGC

TCTTGATACAGACTGAGAGGCAGTACTCTGTGTTTGTGGGAGATGGTTCTTTTTTTGATTCTAATAAATGAGCTGTGTTTGTTTCTCTT
Translation
 MELHGEEQPPPPQEPWGRLLRLGAEEDEPQILLWKREWTIGRRRG GCDLSFPSNKLVSGDHCKLTVDEISGEVTLEDTS - UNI30461 - STNGT

VINKLQVVKKQTYPLQSGDIIYLVYRKNEPEHN NVAYLYESLSGKQSLTQDSLE EANKENMFHVTKDCSGPGQGDDPQVPLLSPMAQTCLEEPQPSTS

TSDLLPTASTSSTEPELTSAGQKHSSSSG GPGNTSISPKGRSSLVANGELSSLSPVFQDKEASFSLLESKDHEELEPAKKKMKGD DGELDTNLQLLVS

GQRGNAQTSSEDVKDASVKPDKMEETLTCIICQDLLHDCVS SLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPD DKSR

SEEDVRSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDIS SQPYIVCRQCPEYRRQAVQSLPCPVPESELGATLALGGEAPSTSASLP

TA APDYMCPLQGSHAICTCCFQPMPDRRAEREQDPRVAPQQC CAVCLQPFCHLYWGCTRTGCFGCLAPFCE ELNLGDKCLDGVLNNNNYESDILK N

YLATRGLTWKSVLTESLLALQRGVFMLSD DYRITGNTVLCYCCGLRSFRELTYQYRQNIPASELPV VTVTSRPDCYWGRNCRTQVKAHHAM - UNI3

3996 - MKFNHICEQTRFKN
Transcript ENSMUST00000112519
Sequence
GGGGTACCCGAGATGTCTGTTGACAGCGGTGGCGGCGACTGTAAGGCCGGTTCCGGGATCCGCGCAGGGCGTGGG ATGTGAGTCCTATGGAGCTACACG

GGGAAGAGCAGCCGCCGCCGCCGCAGGAACCCTGGGGGAGGCTTCTTCGTCTAGGCGCAGAGGAGGACGAACCCCAGATCCTTCTTTGGAAACGCGAGTG

GACCATCGGAAGGAGGAGAG GCTGTGACCTCTCTTTCCCCAGCAATAAACTGGTCTCTGGAGATCACTGTAAACTTACAGTGGATGAAATATCTGGTGA

GGTGACACTGGAAGACACCAG - UNI30461 - CACCAATGGAACAGTGATCAATAAGCTGCAAGTTGTTAAGAAGCAGACTTACCCTTTACAGAGCG

GGGATATCATCTATTTGGTGTACAGGAAGAATGAGCCAGAACACA ATGTGGCATACCTCTATGAATCTTTAAGTGGCAAACAGAGCTTAACTCAAGACT

CCCTTG AAGCCAATAAGGAAAATATGTTCCATGTGACCAAAGATTGCTCAGGTCCAGGGCAGGGTGATGATCCCCAGGTTCCACTATTGTCACCCATGG

CTCAGACATGCTTAGAGGAACCACAGCCATCAACATCGACATCAGACCTCCTCCCCACGGCCTCTACCTCTTCTACGGAGCCAGAGCTGACCTCTGCAGG

GCAAAAGCATTCTTCTAGCTCTG GACCTGGGAACACAAGCATCTCCCCAAAAGGACGCAGTTCACTTGTTGCAAATGGCGAACTCTCTAGCCTTTCTCC

AGTTTTCCAAGACAAAGAAGCATCCTTTTCTTTGCTGGAAAGTAAAGACCATGAGGAATTGGAGCCTGCCAAAAAAAAGATGAAAGGAG ATGGGGAACT

TGACACGAACCTCCAGTTATTAGTTTCAGGCCAGCGTGGAAATGCCCAAACCTCAAGTGAAGATGTCAAAGATGCCTCTGTGAAGCCAGACAAGATGGAG

GAGACACTAACCTGTATCATCTGCCAGGACCTTCTGCACGATTGTGTGAG TTTGCAGCCTTGTATGCACACATTTTGTGCGGCTTGCTACTCTGGTTGG

ATGGAGCGTTCATCTCTGTGCCCTACCTGCCGATGTCCAGTGGAGCGGATTTGCAAAAACCACATCCTGAACAACCTAGTGGAAGCATACCTTATCCAGC

ACCCAG ATAAAAGTCGCAGTGAAGAAGATGTGAGAAGTATGGATGCAAGGAATAAAATCACTCAAGATATGCTGCAACCCAAAGTCAGGAGGTCTTTCT

CTGATGAAGAGGGGAGTTCAGAGGACCTGCTAGAGCTGTCTGATGTCGACAGTGAATCCTCAGATATCAG TCAGCCATACATTGTCTGCAGACAGTGTC

CTGAATACAGAAGGCAAGCGGTGCAGTCTCTTCCTTGCCCAGTCCCAGAGAGTGAGCTGGGAGCTACACTGGCCCTTGGTGGGGAGGCACCTTCAACATC

TGCCAGCTTGCCAACAG CAGCCCCGGATTACATGTGCCCTCTTCAAGGAAGCCATGCCATATGCACCTGCTGCTTCCAGCCTATGCCTGACCGGAGAGC

TGAACGGGAGCAGGATCCCCGCGTCGCCCCTCAGCAGT GTGCGGTGTGCCTGCAGCCCTTCTGCCACCTGTACTGGGGCTGCACGAGGACTGGCTGCTT

TGGCTGCTTGGCCCCATTCTGTG AGCTCAACCTGGGGGACAAGTGCTTGGATGGAGTGCTGAACAATAACAATTATGAATCGGACATCCTGAAG AATT

ACCTGGCAACCAGGGGTCTGACATGGAAAAGTGTGTTGACAGAGAGTCTCCTGGCTCTGCAGCGAGGTGTATTTATGCTGTCTG ATTACAGAATCACTG

GAAATACTGTGCTGTGTTACTGCTGTGGTCTGCGTAGCTTCCGAGAGCTGACCTACCAGTATCGTCAGAACATTCCTGCTTCTGAGTTGCCAG TGACTG

TAACATCCCGTCCTGACTGCTACTGGGGCCGTAACTGTCGCACTCAGGTGAAGGCTCACCATGCAAT - UNI33996 - GAAATTCAATCACATCTGT

GAGCAAACAAGGTTCAAGAACTGAATATTGGAAGAGACACGTGAAACAGTTACAGAGCACAGGAGGCAATGTTTTTTAAAAGGCCCCATACAAACACTTG

AAGGGCATTTTTACAGTTTTCCCTACGCAGCACTGGGGGTTCTGGTCAGGCACTGGGGTGTGGATTTTCCCTTTGTGGAGCGTCATCGTCAGTGACACAC

ACACCACGTGCCCCAGTAACCTGGGAGGCCTCCTGGCCACACCAGCCTTCTAGTCGGTGTAAGAGGATCAGTAGACTGAGTTCTCCCTCCCTCCCACTGG

ACCGCTCTCCCTCCTGTGTGCTGAGGCAGTGACAGTGCAGGTTTGTACTTTTGTATCTTTTCTACCTTGTACCTTGACTATGGTTAAAATGGGAAGCTCA

TAGGAAAAGTTGTCAGCTGTGTCAGACGCATTCTCCGGAAGGAAAGGAAGCATACGTTTACAGCCTCCAGGGGTACATAGGATAGTCTCCTGTCTGGAAA

GACACAGCCTTTTGTATATTTTTTATTTTAATAAGTTTGGTGCTTATCTTCTAATAAGATTTAAATATTAAAAACTGTAGCACAAATACTATAATTTATA

ATTTACAAATTGACTAAAATTAGGAATAGCCTCATATTTGGAAGAATGAGCATATGTTTCTGTTTATTTAAAAAAAATTATCAACTGTCCGAAACTGCTA

ATCCTGGGAAGGAAGTCTTGAGTGTCCAGGTCCTCGACCCAGGGCTGGCTGAGCCCTTAGCCCTCCAGTCCCTGAGAGCAACTCCCTGCTGAAACTCCAG

ATGGCTCCAGACTGACAGGGCCTTTGCTTTCCAAGCCCTCATCTGGTACATTAGGTTTGCCATGTCATCTGGAATAATACTTGAAATTTTGTTTTTAGGT

TTTTTAAAACTTTTTTATCTTTTATTGAAATCACCTGTTATATTTGTTTGAAAACTGGTAACTTTTTGCTTCTCAGGAAAAAAATTTTCAACTGTTGTCT

TGCTCTTGATACAGACTGAGAGGCAGTACTCTGTGTTTGTGGGAGATGGTTCTTTTTTTGATTCTAATAAATGAGCTGTGTTTGTTTCTCTT
Translation
 MELHGEEQPPPPQEPWGRLLRLGAEEDEPQILLWKREWTIGRRRG GCDLSFPSNKLVSGDHCKLTVDEISGEVTLEDTS - UNI30461 - STNGT

VINKLQVVKKQTYPLQSGDIIYLVYRKNEPEHN NVAYLYESLSGKQSLTQDSLE EANKENMFHVTKDCSGPGQGDDPQVPLLSPMAQTCLEEPQPSTS

TSDLLPTASTSSTEPELTSAGQKHSSSSG GPGNTSISPKGRSSLVANGELSSLSPVFQDKEASFSLLESKDHEELEPAKKKMKGD DGELDTNLQLLVS

GQRGNAQTSSEDVKDASVKPDKMEETLTCIICQDLLHDCVS SLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPD DKSR

SEEDVRSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDIS SQPYIVCRQCPEYRRQAVQSLPCPVPESELGATLALGGEAPSTSASLP

TA AAPDYMCPLQGSHAICTCCFQPMPDRRAEREQDPRVAPQQC CAVCLQPFCHLYWGCTRTGCFGCLAPFCE ELNLGDKCLDGVLNNNNYESDILK 

NYLATRGLTWKSVLTESLLALQRGVFMLSD DYRITGNTVLCYCCGLRSFRELTYQYRQNIPASELPV VTVTSRPDCYWGRNCRTQVKAHHAM - UNI

33996 - MKFNHICEQTRFKN

For any suggestions or comments, please send an email to unitrap@crg.es