Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014767 (Tbp)
Chromosomal location
Chr 17: 15636852 - 15654391 (+)
Description
TATA box binding protein Gene [Source:MGI (curated);Acc:Tbp-001]
RefSeq_peptide
NP_038712.3 
UniGene
Mm.244820 Mm.472455 
MGI
MGI:101838 
Uniprot/SWISSPROT
P29037 
Uniprot/SPTREMBL
A2T4N7 Q6LEM2 Q6RI65 Q91YM5 
Human Ortholog
ENSG00000112592 (TBP)
Omim 607136 - SPINOCEREBELLAR ATAXIA 17  
UniTrap UNI16904
Vector Insertion
Chr 17: 15638322 - 15639928
Public Clones not available
Private Clones OST452452 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4273
Vector Insertion
Chr 17: 15639928 - 15640093
Public Clones AH0535 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7409
Vector Insertion
Chr 17: 15644395 - 15650493
Public Clones RRS626 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117593
Sequence
GGCGGGTATCTGCTGGCGGTTTGGCTAGGTTTCTGCGGTCGCGTCATTTTCTCCGCAGTGCCCAGGTAACGGTCCTTTCATCCTTTTCTCTGCTTGGAGG

CCTTAATAAAGGCGACTTCTGCAGCGGGTCCCCGGAGTTTGCCGGAGGAGACGCGAGTGGGCGCGCGGCCGGGCTGGGAACGGTCCTCCGCGCGCGCTGC

GGCGGCTCCGCGAGTAACCAGTCTCTGGACCATCGCCTCGGCGGGGTCCTGAAACCCAGTACCAAGG ACCTGTGTTACATTGCCCCTGCTTTGTGCGAG

TTCCGGCCTCTCAGAAG ACAAAAGAGAGCATTGGACTCCCCAGGACTGGATTTACAGCTAGTT - UNI4273 - - UNI16904 - CATCACTATT

TCATGGTGTGTGAAGATAACCCAGAACATTGAAGACGTTTCTAAGGAGATATTCAGAGGATGCTCTAGGGAAGATCTGAGTACTGAAGAAAGGGAGAATC

ATGGACCAGAACAACAGCCTTCCACCTTATGCTCAGGGCTTGGCCTCCCCACAG - UNI4273 - GGCGCCATGACTCCTGGAATTCCCATCTTTAGT

CCAATGATGCCTTACGGCACAGGACTTACTCCACAGCCTATTCAGAACACCAACAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGC

AACAGCAGCAGCAACAACAGCAGGCAGTAGCAACTGCAGCAGCCTCAGTACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCCAGACCCC

ACAACTCTTCCATTCTCAAACTCTGACCACTGCACCGTTGCCAGGCACCACCCCCTTGTACCCTTCACCAATGACTCCTATGACCCCTATCACTCCTGCC

ACACCAGCTTCTGAGAGCTCTGGAATTGTACCGCAGCTTCA AAATATTGTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTT

CGTGCAAGAAATGCTGAATATAATCCCAAG - UNI7409 - CGATTTGCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAACTGCGTTGATTTTC

AGTTCTGGAAAAATGGTGTGCACAGGAGCCAAGAG TGAAGAACAATCCAGACTAGCAGCAAGAAAATATGCTAGAGTTGTGCAGAAGTTGGGCTTCCCA

GCTAAGTTCTTAGACTTCAAGATCCAGAACATGGTGGGGAGCTGTGATGTGAAGTTCCCTATAAGGCTGGAAGGCCTTGTGCTGACCCACCAGCAGTTCA

GTAG CTATGAGCCAGAATTATTTCCTGGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATTAACAG

 GTGCTAAAGTTAGAGCAGAGATTTATGAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAGGAAGACCACATAGTTGTCTGCCATGTTCTCCT

GCCTTCCCTATCCACGTGTTTTTTAAAACCAGTCAGTTTTGGTACCACTGATGGTACAGTTGGTGAGGACACTCAGTTACAGGTGGCAGCATGAAGTGAC

ACTGTGTGTCCTACTGCAGGATACTAGAAAGGTTCCCCCTCTGCACTGAAATCACCCTGCAGCACTACTGTGAGTTGCTTGCTCTGTGCTGCTACTTGGG

CGGCACTGCCCATTTATTTATATTTAGATTTTAAACACTGCTGTTGGTGATTGTTGGTTTAAGGGACAGAACTTTAAGTGTTCAAGCCACCTGTACAATT

GGACTTTTCATTTTAATCTTTCCCACACAAGCCAGTTTTTATATTTCTACCAGAAAAGTAAAAATCTTTTTTAAAAGTGTTGTTTTTCTAGTTTGTAACT

CTTAGGAGTTATTTTTGTGCCAGATACATTCCGCCTTCCCAGTATTGCAGGACTGAATAGTTGTATTAATCAAAACAATGGCTGTACATACTTTTCTTTC

TTCAGAGTACTCTGCACAAAAACGCAGCTTGTAAATTGTTAGATTTTTGTTATAAATGATACCTTGTAAGTCATGTGATCATACTGTCAAAGAAATTTAT

TTTAGATATAATGCCTGAGACCATT
Translation
   - UNI4273 - - UNI16904 - MDQNNSLPPYAQGLASPQ - UNI4273 - GAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQ

QQQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQ QNIVSTVNLGCKLDL

KTIALRARNAEYNPK - UNI7409 - RFAAVIMRIREPRTTALIFSSGKMVCTGAKS SEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVK

FPIRLEGLVLTHQQFSS SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG GAKVRAEIYEAFENIYPILKGFRKTT
Transcript ENSMUST00000014911
Sequence
GGTGGATCGAGTCCGGTAGCGGTGGCGGGTATCTGCTGGCGGTTTGGCTAGGTTTCTGCGGTCGCGTCATTTTCTCCGCAGTGCCCAG ACCTGTGTTAC

ATTGCCCCTGCTTTGTGCGAGTTCCGGCCTCTCAGAAG - UNI4273 - - UNI16904 - CATCACTATTTCATGGTGTGTGAAGATAACCCAGAA

CATTGAAGACGTTTCTAAGGAGATATTCAGAGGATGCTCTAGGGAAGATCTGAGTACTGAAGAAAGGGAGAATCATGGACCAGAACAACAGCCTTCCACC

TTATGCTCAGGGCTTGGCCTCCCCACAG - UNI4273 - GGCGCCATGACTCCTGGAATTCCCATCTTTAGTCCAATGATGCCTTACGGCACAGGACT

TACTCCACAGCCTATTCAGAACACCAACAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGGCA

GTAGCAACTGCAGCAGCCTCAGTACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCCAGACCCCACAACTCTTCCATTCTCAAACTCTGA

CCACTGCACCGTTGCCAGGCACCACCCCCTTGTACCCTTCACCAATGACTCCTATGACCCCTATCACTCCTGCCACACCAGCTTCTGAGAGCTCTGGAAT

TGTACCGCAGCTTCA AAATATTGTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTTCGTGCAAGAAATGCTGAATATAATCC

CAAG - UNI7409 - CGATTTGCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAACTGCGTTGATTTTCAGTTCTGGAAAAATGGTGTGCACAGG

AGCCAAGAG TGAAGAACAATCCAGACTAGCAGCAAGAAAATATGCTAGAGTTGTGCAGAAGTTGGGCTTCCCAGCTAAGTTCTTAGACTTCAAGATCCA

GAACATGGTGGGGAGCTGTGATGTGAAGTTCCCTATAAGGCTGGAAGGCCTTGTGCTGACCCACCAGCAGTTCAGTAG CTATGAGCCAGAATTATTTCC

TGGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATTAACAG GTGCTAAAGTTAGAGCAGAGATTTA

TGAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAGGAAGACCACATAGTTGTCTGCCATGTTCTCCTGCCTTCCCTATCCACGTGTTTTTTAA

AACCAGTCAGTTTTGGTACCACTGATGGTACAGTTGGTGAGGACACTCAGTTACAGGTGGCAGCATGAAGTGACACTGTGTGTCCTACTGCAGGATACTA

GAAAGGTTCCCCCTCTGCACTGAAATCACCCTGCAGCACTACTGTGAGTTGCTTGCTCTGTGCTGCTACTTGGGCGGCACTGCCCATTTATTTATATTTA

GATTTTAAACACTGCTGTTGGTGATTGTTGGTTTAAGGGACAGAACTTTAAGTGTTCAAGCCACCTGTACAATTGGACTTTTCATTTTAATCTTTCCCAC

ACAAGCCAGTTTTTATATTTCTACCAGAAAAGTAAAAATCTTTTTTAAAAGTGTTGTTTTTCTAGTTTGTAACTCTTAGGAGTTATTTTTGTGCCAGATA

CATTCCGCCTTCCCAGTATTGCAGGACTGAATAGTTGTATTAATCAAAACAATGGCTGTACATACTTTTCTTTCTTCAGAGTACTCTGCACAAAAACGCA

GCTTGTAAATTGTTAGATTTTTGTTATAAATGATACCTTGTAAGTCATGTGATCATACTGTCAAAGAAATTTATTTTAGATATAATGCCTGAGACCATT
Translation
  - UNI4273 - - UNI16904 - MDQNNSLPPYAQGLASPQ - UNI4273 - GAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ

QQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQ QNIVSTVNLGCKLDLK

TIALRARNAEYNPK - UNI7409 - RFAAVIMRIREPRTTALIFSSGKMVCTGAKS SEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKF

PIRLEGLVLTHQQFSS SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG GAKVRAEIYEAFENIYPILKGFRKTT
Transcript ENSMUST00000118001
Sequence
ACGGCATCAGATGTGCGTCAGGCGTTCGGTGGATCGAGTCCGGTAGCGGTGGCGGGTATCTGCTGGCGGTTTGGCTAGGTTTCTGCGGTCGCGTCATTTT

CTCCGCAGTGCCCAG - UNI4273 - - UNI16904 - CATCACTATTTCATGGTGTGTGAAGATAACCCAGAACATTGAAGACGTTTCTAAGGAGA

TATTCAGAGGATGCTCTAGGGAAGATCTGAGTACTGAAGAAAGGGAGAATCATGGACCAGAACAACAGCCTTCCACCTTATGCTCAGGGCTTGGCCTCCC

CACAG - UNI4273 - GGCGCCATGACTCCTGGAATTCCCATCTTTAGTCCAATGATGCCTTACGGCACAGGACTTACTCCACAGCCTATTCAGAACA

CCAACAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGGCAGTAGCAACTGCAGCAGCCTCAGT

ACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCCAGACCCCACAACTCTTCCATTCTCAAACTCTGACCACTGCACCGTTGCCAGGCACC

ACCCCCTTGTACCCTTCACCAATGACTCCTATGACCCCTATCACTCCTGCCACACCAGCTTCTGAGAGCTCTGGAATTGTACCGCAGCTTCA AAATATT

GTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTTCGTGCAAGAAATGCTGAATATAATCCCAAG - UNI7409 - CGATTT

GCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAACTGCGTTGATTTTCAGTTCTGGAAAAATGGTGTGCACAGGAGCCAAGAG CTATGAGCCAGAA

TTATTTCCTGGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATTAACAG GTGCTAAAGTTAGAGCA

GAGATTTATGAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAGGAAGACCACATAGTTGTCTGCCATGTTCTCCTGCCTTCCCTATCCACGTG

TTTTTTAAAACCAGTCAGTTTTGGTACCACTGATGGTACAGTTGGTGAGGACACTCAGTTACAGGTGGCAGCATGAAGTGACACTGTGTGTCCTACTGCA

GGATACTAGAAAGGTTCCCCCTCTGCACTGAAATCACCCTGCAGCACTACTGTGAGTTGCTTGCTCTGTGCTGCTACTTGGGCGGCACTGCCCATTTATT

TATATTTAGATTTTAAACACTGCTGTTGGTGATTGTTGGTTTAAGGGACAGAACTTTAAGTGTTCAAGCCACCTGTACAATTGGACTTTTCATTTTAATC

TTTCCCACACAAGCCAGTTTTTATATTTCTACCAGAAAAGTAAAAATCTTTTTTAAAAGTGTTGTTTTTCTAGTTTGTAACTCTTAGGAGTTATTTTTGT

GCCAGATACATTCCGCCTTCCCAGTATTGCAGGACTGAATAGTTGTATTAATCAAAACAATGGCTGTACATACTTTTCTTTCTTCAGAGTACTCTGCACA

AAAACGCAGCTTGTAAATTGTTAGATTTTTGTTATAAATGATACCTTGTAAGTCATGTGATCATACTGTCAAAGAAATTTATTTTAGATATAATGCCTGA

GACCATT
Translation
 - UNI4273 - - UNI16904 - MDQNNSLPPYAQGLASPQ - UNI4273 - GAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQ

QQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQ QNIVSTVNLGCKLDLKT

IALRARNAEYNPK - UNI7409 - RFAAVIMRIREPRTTALIFSSGKMVCTGAKS SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG GAKVRAEI

YEAFENIYPILKGFRKTT
Transcript ENSMUST00000119879
Sequence
AAGAGCGCAACTGGCGGAAGTGACGGCATCAGATGTGCGTCAGGCGTTCGGTGGATCGAGTCCGGTAGCGGTGGCGGGTATCTGCTGGCGGTTTGGCTAG

GTTTCTGCGGTCGCGTCATTTTCTCCGCAGTGCCCAG - UNI4273 - - UNI16904 - CATCACTATTTCATGGTGTGTGAAGATAACCCAGAAC

ATTGAAGACGTTTCTAAGGAGATATTCAGAGGATGCTCTAGGGAAGATCTGAGTACTGAAGAAAGGGAGAATCATGGACCAGAACAACAGCCTTCCACCT

TATGCTCAGGGCTTGGCCTCCCCACAG - UNI4273 - GGCGCCATGACTCCTGGAATTCCCATCTTTAGTCCAATGATGCCTTACGGCACAGGACTT

ACTCCACAGCCTATTCAGAACACCAACAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGGCAG

TAGCAACTGCAGCAGCCTCAGTACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCCAGACCCCACAACTCTTCCATTCTCAAACTCTGAC

CACTGCACCGTTGCCAGGCACCACCCCCTTGTACCCTTCACCAATGACTCCTATGACCCCTATCACTCCTGCCACACCAGCTTCTGAGAGCTCTGGAATT

GTACCGCAGCTTCA AAATATTGTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTTCGTGCAAGAAATGCTGAATATAATCCC

AAG - UNI7409 - CGATTTGCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAACTGCGTTGATTTTCAGTTCTGGAAAAATGGTGTGCACAGGA

GCCAAGAG TGAAGAACAATCCAGACTAGCAGCAAGAAAATATGCTAGAGTTGTGCAGAAGTTGGGCTTCCCAGCTAAGTTCTTAGACTTCAAGATCCAG

AACATGGTGGGGAGCTGTGATGTGAAGTTCCCTATAAGGCTGGAAGGCCTTGTGCTGACCCACCAGCAGTTCAGTAG CTATGAGCCAGAATTATTTCCT

GGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATTAACAG GTGCTAAAGTTAGAGCAGAGATTTAT

GAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAGGAAGACCACATAGTTGTCTGCCATGTTCTCCTGCCTTCCCTATCCACGTGTTTTTTAAA

ACCAGTCAGTTTTGGTACCACTGATGGTACAGTTGGTGAGGACACTCAGTTACAGGTGGCAGCATGAAGTGACACTGTGTGTCCTACTGCAGGATACTAG

AAAGGTTCCCCCTCTGCACTGAAATCACCCTGCAGCACTACTGTGAGTTGCTTGCTCTGTGCTGCTACTTGGGCGGCACTGCCCATTTATTTATATTTAG

ATTTTAAACACTGCTGTTGGTGATTGTTGGTTTAAGGGACAGAACTTTAAGTGTTCAAGCCACCTGTACAATTGGACTTTTCATTTTAATCTTTCCCACA

CAAGCCAGTTTTTATATTTCTACCAGAAAAGTAAAAATCTTTTTTAAAAGTGTTGTTTTTCTAGTTTGTAACTCTTAGGAGTTATTTTTGTGCCAGATAC

ATTCCGCCTTCCCAGTATTGCAGGACTGAATAGTTGTATTAATCAAAACAATGGCTGTACATACTTTTCTTTCTTCAGAGTACTCTGCACAAAAACGCAG

CTTGTAAATTGTTAGATTTTTGTTATAAATGATACCTTGTAAGTCATGTGATCATACTGTCAAAGAAATTTATTTTAGATATAATGCCTGAGACCATT
Translation
 - UNI4273 - - UNI16904 - MDQNNSLPPYAQGLASPQ - UNI4273 - GAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQ

QQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQ QNIVSTVNLGCKLDLKT

IALRARNAEYNPK - UNI7409 - RFAAVIMRIREPRTTALIFSSGKMVCTGAKS SEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFP

IRLEGLVLTHQQFSS SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG GAKVRAEIYEAFENIYPILKGFRKTT
Transcript ENSMUST00000080441
Sequence
GGTGGATCGAGTCCGGTAGCGGTGGCGGGTATCTGCTGGCGGTTTGGCTAGGTTTCTGCGGTCGCGTCATTTTCTCCGCAGTGCCCAG ACCTGTGTTAC

ATTGCCCCTGCTTTGTGCGAGTTCCGGCCTCTCAGAAG - UNI4273 - - UNI16904 - CATCACTATTTCATGGTGTGTGAAGATAACCCAGAA

CATTGAAGACGTTTCTAAGGAGATATTCAGAGGATGCTCTAGGGAAGATCTGAGTACTGAAGAAAGGGAGAATCATGGACCAGAACAACAGCCTTCCACC

TTATGCTCAGGGCTTGGCCTCCCCACAG - UNI4273 - GGCGCCATGACTCCTGGAATTCCCATCTTTAGTCCAATGATGCCTTACGGCACAGGACT

TACTCCACAGCCTATTCAGAACACCAACAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAGGCA

GTAGCAACTGCAGCAGCCTCAGTACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCCAGACCCCACAACTCTTCCATTCTCAAACTCTGA

CCACTGCACCGTTGCCAGGCACCACCCCCTTGTACCCTTCACCAATGACTCCTATGACCCCTATCACTCCTGCCACACCAGCTTCTGAGAGCTCTGGAAT

TGTACCGCAGCTTCA AAATATTGTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTTCGTGCAAGAAATGCTGAATATAATCC

CAAG - UNI7409 - CGATTTGCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAACTGCGTTGATTTTCAGTTCTGGAAAAATGGTGTGCACAGG

AGCCAAGAG CTATGAGCCAGAATTATTTCCTGGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATT

AACAG GTGCTAAAGTTAGAGCAGAGATTTATGAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAGGAAGACCACATAGTTGTCTGCCATGTT

CTCCTGCCTTCCCTATCCACGTGTTTTTTAAAACCAGTCAGTTTTGGTACCACTGATGGTACAGTTGGTGAGGACACTCAGTTACAGGTGGCAGCATGAA

GTGACACTGTGTGTCCTACTGCAGGATACTAGAAAGGTTCCCCCTCTGCACTGAAATCACCCTGCAGCACTACTGTGAGTTGCTTGCTCTGTGCTGCTAC

TTGGGCGGCACTGCCCATTTATTTATATTTAGATTTTAAACACTGCTGTTGGTGATTGTTGGTTTAAGGGACAGAACTTTAAGTGTTCAAGCCACCTGTA

CAATTGGACTTTTCATTTTAATCTTTCCCACACAAGCCAGTTTTTATATTTCTACCAGAAAAGTAAAAATCTTTTTTAAAAGTGTTGTTTTTCTAGTTTG

TAACTCTTAGGAGTTATTTTTGTGCCAGATACATTCCGCCTTCCCAGTATTGCAGGACTGAATAGTTGTATTAATCAAAACAATGGCTGTACATACTTTT

CTTTCTTCAGAGTACTCTGCACAAAAACGCAGCTTGTAAATTGTTAGATTTTTGTTATAAATGATACCTTGTAAGTCATGTGATCATACTGTCAAAGAAA

TTTATTTTAGATATAATGCCTGAGACCATT
Translation
  - UNI4273 - - UNI16904 - MDQNNSLPPYAQGLASPQ - UNI4273 - GAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ

QQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQ QNIVSTVNLGCKLDLK

TIALRARNAEYNPK - UNI7409 - RFAAVIMRIREPRTTALIFSSGKMVCTGAKS SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG GAKVRAE

IYEAFENIYPILKGFRKTT

For any suggestions or comments, please send an email to unitrap@crg.es