Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014856 (Tmem208)
Chromosomal location
Chr 8: 107850277 - 107858774 (+)
Description
transmembrane protein 208 Gene [Source:MGI (curated);Acc:Tmem208-003]
RefSeq_dna
NM_025486 
RefSeq_peptide
NP_079762.1 
MGI
MGI:1913570 
Uniprot/SWISSPROT
Q9CR96 
Human Ortholog
ENSG00000168701 (TMEM208)
Omim not available
UniTrap UNI30202
Vector Insertion
Chr 8: 107850375 - 107850950
Public Clones D080G05 (ggtc) IST11553G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15823
Vector Insertion
Chr 8: 107851047 - 107852069
Public Clones not available
Private Clones OST472416 (lexicon) OST413565 (lexicon) OST40346 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19230
Vector Insertion
Chr 8: 107852130 - 107852221
Public Clones not available
Private Clones OST400071 (lexicon) OST58877 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12498
Vector Insertion
Chr 8: 107852593 - 107852671
Public Clones W174F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109372
Sequence
GCGCACCATGGCG - UNI30202 - CCCAAAGGAAAAGTGGGTACCAGAGGGAAGAAACAGATATTTGAAGAGAACAAAGAAACTCTCAAGTTTTACC

TTCGGATCATACTGGGAGCCAAC - UNI15823 - GCCATCTACTGCCTTGTAACCTTGGTCTTCTTCTATTCCTCTGCCTCATTCTGGGCCTGG - 

UNI19230 - ATGGCCCTGGGCTTTAGCTTGGCCGTGTACGGGGCCAGCTACCACTCTATGAGCTCGATGGCTCGGGCATCCTTCTCTGAGGATGGGTC

CTTGATGGATGGTGGCATGGACCTCAACATGGAGCAGGGCATGGCAGA - UNI12498 - GCTCCAGGCCGGGCCCTTTACCTTTTGTGGGTAAACGT

GCTGGGCCCCTGGTTCACAGCAGACAGTGGAGCCCCTGCACCAGAGCTCAATGAGAAACGACAACGCCGACAGGAGCGGCGGCAGATGAAAAG
Translation
MA - UNI30202 - PKGKVGTRGKKQIFEENKETLKFYLRIILGAN - UNI15823 - AIYCLVTLVFFYSSASFWAW - UNI19230 - MALG

FSLAVYGASYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAE - UNI12498 - ELQAGPFTFCG
Transcript ENSMUST00000015000
Sequence
ACCGGAAGTGCATGTGCTGCCGATGTGGTGTCTACTGACTGCAGTTCCAGTTACTCGCCCTTGTTTCAGTGGCTGGGTGTCTGCTGCGCACCATGGCG -

 UNI30202 - CCCAAAGGAAAAGTGGGTACCAGAGGGAAGAAACAGATATTTGAAGAGAACAAAGAAACTCTCAAGTTTTACCTTCGGATCATACTGG

GAGCCAAC - UNI15823 - GCCATCTACTGCCTTGTAACCTTGGTCTTCTTCTATTCCTCTGCCTCATTCTGGGCCTGG - UNI19230 - ATGG

CCCTGGGCTTTAGCTTGGCCGTGTACGGGGCCAGCTACCACTCTATGAGCTCGATGGCTCGGGCATCCTTCTCTGAGGATGGGTCCTTGATGGATGGTGG

CATGGACCTCAACATGGAGCAGGGCATGGCAGA GCACCTTAAGGATGTGATCCTACTGACAGCCATTGTTCAGGTGCTCAGCTGTTTCTCCCTCTACAT

CTGGTCCTTCTGGCTTCTG - UNI12498 - GCTCCAGGCCGGGCCCTTTACCTTTTGTGGGTAAACGTGCTGGGCCCCTGGTTCACAGCAGACAGTG

GAGCCCCTGCACCAGAGCTCAATGAGAAACGACAACGCCGACAGGAGCGGCGGCAGATGAAAAGGTTATAGCATCCTTAACTGAGGCTGTAGGCTGCTGG

GCACTGGTTGGCTCTGTTATGCTGCGTGGCCCCATGCCTGGAGCAGTGAGGGCCTAGTTTAAGGGCCAAAGCAGCCTGGATTATAGGATCACTAAATAAA

TAGTTTCGAATGT
Translation
MA - UNI30202 - PKGKVGTRGKKQIFEENKETLKFYLRIILGAN - UNI15823 - AIYCLVTLVFFYSSASFWAW - UNI19230 - MALG

FSLAVYGASYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAE EHLKDVILLTAIVQVLSCFSLYIWSFWLL - UNI12498 - APGRALYLLWVNVL

GPWFTADSGAPAPELNEKRQRRQERRQMKRL
Transcript ENSMUST00000098453
Sequence
ACCGGAAGTGCATGTGCTGCCGATGTGGTGTCTACTGACTGCAGTTCCAGTTACTCGCCCTTGTTTCAGTGGCTGGGTGTCTGCTGCGCACCATGGCG -

 UNI30202 - CCCAAAGGAAAAGTGGGTACCAGAGGGAAGAAACAGATATTTGAAGAGAACAAAGAAACTCTCAAGTTTTACCTTCGGATCATACTGG

GAGCCAAC - UNI15823 - GCCATCTACTGCCTTGTAACCTTGGTCTTCTTCTATTCCTCTGCCTCATTCTGGGCCTGG - UNI19230 - ATGG

CCCTGGGCTTTAGCTTGGCCGTGTACGGGGCCAGCTACCACTCTATGAGCTCGATGGCTCGGGCATCCTTCTCTGAGGATGGGTCCTTGATGGATGGTGG

CATGGACCTCAACATGGAGCAGGGCATGGCAGA - UNI12498 - GGTTGGTTTCTTTAGCGGCTGGATTCTGCCTGAGCATCACCCACCTGATGATC

CATCAGTGTCATCTACCGTGGCTCCAGCCAGCGTCTCCGCTCGGCCTTGGGCCAGAGCAGCCTGCTTCTCCGTCTCTGCTGCCGCCACATTCTCCAGGAA

CCGGGCTCTGAAGAGAGAGGCATGTCAACGGTGGTGTCTGACCCAAGTCCAGCCCAGGGTGGCACACATGCCTTGCTGA
Translation
MA - UNI30202 - PKGKVGTRGKKQIFEENKETLKFYLRIILGAN - UNI15823 - AIYCLVTLVFFYSSASFWAW - UNI19230 - MALG

FSLAVYGASYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAE - UNI12498 - EVGFFSGWILPEHHPPDDPSVSSTVAPASVSARPWARAACFSVS

AAATFSRNRALKREACQRWCLTQVQPRVAHMPC

For any suggestions or comments, please send an email to unitrap@crg.es