Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014867 (Surf4)
Chromosomal location
Chr 2: 26775561 - 26788927 (-)
Description
surfeit gene 4 Gene [Source:MGI (curated);Acc:Surf4-001]
RefSeq_dna
NM_011512 
RefSeq_peptide
NP_035642.1 
UniGene
Mm.300594 
MGI
MGI:98445 
Uniprot/SWISSPROT
Q64310 
Uniprot/SPTREMBL
Q3U7E6 Q545Q2 
Human Ortholog
ENSG00000148248 (SURF4)
Omim not available
UniTrap UNI25270
Vector Insertion
Chr 2: 26782476 - 26788794
Public Clones E127A05 (ggtc)
Private Clones OST189715 (lexicon) OST57409 (lexicon) OST15607 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22979
Vector Insertion
Chr 2: 26780052 - 26780472
Public Clones not available
Private Clones OST279645 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015011
Sequence
CGAGGCCGGCCGCCGGGTACTTCCTGTGGAGGCCGCAGCAGGCGCGAGCGCCCAGGACCTGCCAGCTGAGCCTTCCGCCGCCGCCATGGGACAGAACGAC

CTGATGGGCACGGCCGAGGACTTCGCCGACCAG - UNI25270 - TTCCTTCGAGTCACCAAGCAGTACCTGCCTCATGTGGCGCGCCTCTGCCTGAT

CAGCACCTTCCTGGAGGATGGCATCCGCATGTGGTTCCAGTGGAGTGAGCAGCGTGACTATATCGACACCACCTGGAGCTGTGGCTACCTGTTGGCCTCA

TCCTTCGTGTTCCTCAACCTGCTGGGACAATTGA CTGGCTGTGTTTTGGTGCTGAGCAGGAACTTCGTGCAGTATGCCTGCTTTGGGCTGTTTGGAATC

ATCGCACTGCAG ACAATTGCCTATAGCATTTTGTGGGACTTGAAGTTTCTCATGAG - UNI22979 - GAACCTGGCTTTAGGAGGAGGTTTGCTGC

TGCTCTTGGCAGAATCCCGCTCAGAAGGGAAGAGCATGTTTGCTGGTGTCCCAACCATGCGTGAGAGCTCCCCCAAGCAGTACATGCAGCTTGGAGGAAG

GGTCCTGCTGGTCCTGATGTTCATGACCCTCCTTCACTTTGATGCCAGCTTCTTTTCT ATCATCCAGAACATTGTGGGCACAGCTCTGATGATCTTAGT

AGCCATCGGTTTTAAAACCAAGCTGGCAGCTTTGACTCTCGTCGTCTGGCTGTTTGCCATCAACGTGTATTTCAACGCCTTCTGGACAATCCCGGTATAT

AAACCCATGCATGACTTCCTGAAATACGACTTCTTCCAGACCATGTCAGTGATTGGAGGCCTGCTCCTGGTGGTGGCTCTTGGCCCAGGGGGTGTGTCCA

TGGATGAGAAGAAGAAAGAGTGGTAACACACAGATCCCTCCCCTCCCTGGCTGAGGCACAGGGCCCTGGCCTGGTTCAGGGCAGAGTCAACAAACTGCCG

GCGTTTGTGTGTCCTTCTCCCTTCCCCTCCCTTGGTAAAGGCACAGATGTTTTGAGAACTTTATTTGCAGACACCTGAAAATTGGAGATAAAATCTTTGG

AAATAGTCTGGAGTCTTGACTGTCCAGGGCTGGCGAGCTGGATGGTCACTCCTTAGCCAAGGCTTGGAGGAGACAGCGTGCTGGGCTGTGGCCTCATTCC

TCCTGTCTCCGAGTTCCTTTTGGGGAAGTCGTACTGAGCTGTATTTTTATCATTCAAAGCAGTTTCCCTTCTTAGTTTTGAGTTTACATCCTTAGCTCAA

ACTACTAAATGACTTAGGATAGTCCAGCCAAACACCAAACGGTTAAACCTCCAGTTCAGAATTCTACCAGTGGCCCCAGCATTGCTTCTGCCCCTGTATT

TTATAGGATCAGTGAAGATGTTAGAGAAACCAAGTCAAGAGAACAGTACAGTATTGGAAAGGTGGGTGTTACTGCTGTCCCAAGTCCTTGATGTTAGCTA

GCTGGATGCTGTTTACTGGGTGAAAGGTACCTTGGGAGTTTTCATGGCTCCAAGCAGGGATGGGATGGGGTAAGCAGCAGGAAGTTCTTAGAAAGCTGCT

ATCCCTCAAGCTTGGTGGTGGAAAGGGCAGGAGAGCAGGCTGCTCACAGGATGGCCCACACAACCACCATGGAACCAGCCTGGGAACAGCGATGCCATGG

GGCCCAGAAGTGAGGAGTCCCAGTACTCAAGACACCCAGGCTCAACCCAGTTACCTCACACTTGACCTTCTCAGAGCAAGGCCTGAACTCCACAGGTTGT

GGTCCCCAACCCCCAGCTTAACTCCCTGTTCCAGGCTGAGCCGACCCCGTCGACAGCCCTGATACCACCATTCCCCTGAGGCTGTTGCTTGCTCAGATTT

TTGTCAACTTGCTCTGCTGTATGCAGCCAAGATACTTTTTACAATTTGTGATGCCTTACCAATTTGATCTCAGTCCTGTATTTAAAGTTTTCTAACATTG

CCTTACACCGTGTTTCTCTTTTTGGGGGAGGGGTGGGGTGTCTAATGCTGTGGTCTTGCTCATCTGCATGGTAGTGCCATGAGGGTAGTTGGGTTCCTCC

TGGATCTCTCCCAGGTCTGTTGGAGAGAACAGACAGACTTAGAACCCCTGGAGGGAAGCTGGCAGCTTACCTCACCCTTGGGTACAGAGTCTTGGAGGTC

CTCCTTTCTGGCATCAGCTGGGTAGGCAGGACTTTGTTCTCTGAGTCACTTTGGGTCAGTCCCTTGCCTCGCTGGCTCTGCAGGCTGAATTCACCTTCTC

AACACCTAGCCCATGTTTTCCTGCAGCCTTATGGCCTGCCTATTCCTCCCAAGTGAGTTCCAGCACTGGCTCAGGCCATGCTAGTTCTTTACCACAGAGC

TGCCTCAGTGCACAGCCACCTGCAGTGGCAGCCCCATGACATTCCAGTCTGTGGAGTGGGGCAGACCCTGGGAGGCAAGTGCATGCCGTGCAGCAGAAGC

CCTCGTCCCAGGGTTACTTAGCCCTTTGACCAGCCTCCTGTGGGTTCTGCCTGGGATGGGAACCCTCATCCCAAGGGTACTTGGCCCATTTACCAGCCTC

CTGTGGGGTGCGCCTGGGACGGGAGAAAACAATGATACACATATTGGTTTGGCAAAAGTTTTCTGAAGATGCTTTAGCTTTATGTGGGAATAGGTATAAA

CCTCATTTTTATGCTGTATTTTATATCTTAGTTGTGTTTGAAAATGTTTTGATCTTTGGAAACATCAAAATAAATAATGGCATTTGTGGT
Translation
MGQNDLMGTAEDFADQ - UNI25270 - FLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWSCGYLLASSFVFLNLLGQLT TGCVLV

LSRNFVQYACFGLFGIIALQ TIAYSILWDLKFLMR - UNI22979 - RNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLM

FMTLLHFDASFFS IIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKK

EW

For any suggestions or comments, please send an email to unitrap@crg.es