Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014932 (Yes1)
Chromosomal location
Chr 5: 32913606 - 32989430 (+)
Description
Yamaguchi sarcoma viral (v-yes) oncogene homolog 1 Gene [Source:MGI Symbol;Acc:MGI:99147]
RefSeq_dna
NM_009535 
RefSeq_peptide
NP_033561.1 
UniGene
Mm.395218 
MGI
MGI:99147 
Uniprot/SWISSPROT
Q04736 
Uniprot/SPTREMBL
Q3TJI7 Q8C6U9 Q8C762 Q8CBP1 
Human Ortholog
ENSG00000176105 (YES1)
Omim not available
UniTrap UNI14684
Vector Insertion
Chr 5: 32914211 - 32942703
Public Clones (sanger) E021D08 (ggtc) 3SE311A10 (ggtc) D086F11 (ggtc) P139C03 (ggtc)
D086H11 (ggtc) D086E11 (ggtc) E091B03 (ggtc) 5SE311A10 (ggtc) D051D09 (ggtc)
CMHD-GT_518B8-5S (cmhd) FHCRC-GT-S1-6E1 (fhcrc) IST14465D8 (tigm) IST10271G9 (tigm)
IST11537D8 (tigm) IST10264H6 (tigm) IST12677F1HMF1 (tigm) IST11878E9 (tigm)
IST14957G7 (tigm) IST14757G2 (tigm) IST14996E10 (tigm) IST12452H10 (tigm)
IST14560F12 (tigm) IST14304E8 (tigm) IST12862C1 (tigm) IST11537A6 (tigm)
IST14282D8 (tigm) IST11879E9 (tigm)
Private Clones OST451775 (lexicon) OST314079 (lexicon) OST219524 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14472
Vector Insertion
Chr 5: 32942977 - 32947380
Public Clones FHCRC-GT-S11-3H1 (fhcrc)
Private Clones OST464240 (lexicon) OST411982 (lexicon) OST341078 (lexicon) OST261607 (lexicon)
OST179437 (lexicon) OST174797 (lexicon) OST148720 (lexicon) OST130388 (lexicon)
OST62823 (lexicon) OST62339 (lexicon) OST50227 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20781
Vector Insertion
Chr 5: 32947481 - 32954029
Public Clones (sanger) IST11795B3 (tigm)
Private Clones OST352419 (lexicon) OST226815 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18756
Vector Insertion
Chr 5: 32955680 - 32957478
Public Clones not available
Private Clones OST415017 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5051
Vector Insertion
Chr 5: 32963279 - 32966641
Public Clones RHA164 (baygenomics) YTC513 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9273
Vector Insertion
Chr 5: 32966774 - 32986923
Public Clones (sanger) XG179 (baygenomics) XG698 (baygenomics) IST13979E2 (tigm)
IST13580E8 (tigm) IST12433D3 (tigm) IST15089D5 (tigm) IST12888H8 (tigm)
IST14137B10 (tigm) IST11565B3 (tigm) IST11209E7 (tigm) IST11028G6 (tigm)
IST14617G12 (tigm) IST10699A11 (tigm) IST14940A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072311
Sequence
GCGTCCCGGGCCGGCTGCGCCGCCGTCGCTGCCTCCTGGCGCCCCGCGACCTGGAGGTGGAGAAGGGAGAGGGACCCGCGGGCGTCCACCTCGGCCGGCC

GCCTTCTCCCCGCGGCGACCCGTGCGAGTGCGGCCGGACTCAGGTAAGCTCGCGGCGTGGCCTCGCGACGTAGGCAGCTGACCCGGACCGGGCAGCTCTA

GGCCTCGGCATCCACCCTCCTGCTCCCGGGCTTCTCGAGGCGCCGCCGCCCCTGCCGCTGTCCGCCTACTGGTCCCGGAGTCTGGAAGTTGAGGAGAAAC

TTCTCCCCTCCCGCGGTCTGGCTGGCGGGCGTGAGTGTCTCGTCTCCTGGGCTCACTACCTGCTTGCCCAGTGCCTCGGTCTCCGCCCTGTCCAGTACTT

CCCGATTCTGCGGGAGTCCGGATAGTGGTCCAGCCTATGTGGTGCCGCCGCTGCACCCTCCACCCCAAAGGACGTGGGGTCACTCCCGAATGAGGACCAG

AGGGTAGGGCAGCGGCCCCTTCTCGTCCTAGCGGCTGGAGGTCTGTGTCGCCGGACGCCCGCAGCAACTGTCTGGAGCGAGGAGTGGAACTCGTGGAGCG

AGCGG - UNI14684 - ATTTGATAATGGGCTGCATTAAAAGTAAAGAAAACAAAAGTCCAGCCATAAAATACACACCGGAAAATCTTACAGAGCCTG

TAAGCCCAAGTGCCAGTCATTATGGAGTGGAACATGCTACAGTTGCCCCGACCTCTTCCACAAAGGGAGCATCAGTTAATTTTAACAGTCTTTCCATGAC

ACCCTTTGGAGGGTCCTCAGGGGTGACTCCTTTTGGAGGAGCGTCTTCCTCATTCTCAGTGGTGTCAAGTTCATATCCTACAGGTTTAACAG - UNI14

472 - GTGGTGTCACTATATTTGTGGCCTTGTATGATTATGAAGCTAGAACTACAGAAGACCTTTCCTTTAAGAAGGGTGAACGATTTCAAATAATTAA

CAATAC - UNI20781 - GGAAGGAGACTGGTGGGAAGCAAGATCAATTGCTACCGGAAAGAGTGGTTATATCCCTAGCAATTACGTAGTGCCTGCAG

ATTCCATTCAGGCAGAAGA ATGGTATTTTGGCAAAATGGGGAGAAAAGATGCGGAAAGATTACTTCTGAATCCTGGGAATCAGCGAGGTATTTTCTTAG

TAAGAGAAAGTGAAACTACTAAAG GTGCTTACTCCCTCTCAATCCGTGATTGGGATGAGGTGAGGGGTGACAATGTGAAGCATTACAAGATCAGAAAAC

TTGACAATGGTGGCTACTACATCACGACCAGAGCTCAGTTTGATACACTGCAGAAGCTGGTGAAGCACTACACAG - UNI18756 - AACATGCTGAT

GGATTATGCCACAAGTTAACAACTGTGTGTCCTACTGTGAAACCCCAGACTCAAGGTCTGGCAAAAGATGCTTGGGAAATCCCTCGAGAATCATTGCGAC

TAGAGGTGAAACTAGGTCAAGGATGCTTTGGGGAAGTGTGGATGG GAACATGGAATGGAACTACAAAAGTAGCAATCAAAACACTAAAGCCAGGTACAA

TGATGCCAGAAGCATTCCTTCAAGAAGCTCAGATAATGAAAAAGCTAAGACACGATAAACTTGTTCCACTCTATGCAGTTGTTTCTGAAGAGCCCATTTA

TATTGTCACCGAGTTTATGTCAAAAG GAAGCTTGTTAGATTTCCTTAAAGAAGGAGATGGAAAGTATTTGAAGCTTCCACAGCTGGTTGATATGGCTGC

TCAG ATCGCTGATGGCATGGCGTATATTGAAAGAATGAACTATATTCACCGAGATCTCCGAGCTGCTAATATTCTTGTAGGAGAAAATCTTATATGCAA

AATAGCAGATTTTGGCTTAGCAAGATTAATTGAAGACAATGAATACACGGCAAGACAAG - UNI5051 - GTGCAAAATTTCCAATCAAGTGGACAGC

TCCTGAGGCTGCTCTGTATGGTCGATTTACAATAAAGTCAGATGTGTGGTCATTTGGAATTCTACAGACAGAGCTGGTAACAAAAGGAAGAGTGCCATAT

CCAG - UNI9273 - GTATGGTAAACCGTGAAGTATTGGAACAAGTAGAGCGGGGATACAGAATGCCTTGCCCCCAGGGCTGTCCCGAATCCCTCCAT

GAATTGATGAATCTTTGCTGGAAGAAGGATCCTGATGAAAGACCAACATTTGAATATATTCAGTCCTTCTTGGAAGACTACTTCACTGCTACAGAGCCAC

AGTACCAACCAGGAGAAAATTTATAATCCAAGTAACCTGTGTGCACAGATCTGCCAAAACAGAGAGACCTTGTGTGAGTTCTTCCTGCACAGAAATGAGA

AGATATGCTTCACTCGGCATGTTTCTTATGGTAAACTGGAATTCCAGATACGGTTACTCAAAACCACTTTTTTTTTCTCCAAGCATTAAACTCTAAAGTA

CCAATGATGCATCTTACAGCATACTTCAGGGTCCAGAGAAAGTAGAGCTAGAGAGTGTGATTGTGGGTGTAGCATGGTAAGAAAGAGCAACAGGACTACT

GGTCATTGCCTTTTCTTCCCCAAACTTGCCAAGAGAAAACTACTTCTTGGTATGTATAAAACTTGGCTGTTACTCCACAGGAAAATTCTAAGATCAAAGA

ACTTCATGGGACCAAATAATTCCATTCCAGTTTTTTAAATTTTCTAGAATTTTTTTTCTCAAAGTTTTTTTTTGTTTGTTTTGTTCTGTTTTTTCCCTGT

TTAATAGTCAACATGCACTCCTATCAGAGGCCTCCTTTTGTGTGAAAATGGGCCAAGTCTTCCAAATGCAAAGGAATGGATTATAAACAGCATCAAAAAC

ATTGATTTAAAAAGCCATGGAAGTTAGAAGCATAATACAGTATGCTCACACTTTGTCCAGAGAACTGGAAAGCAAAACAAATTTTTCATATCAGTCATGT

CTTAAATTGTTCAGCTTTGAATAATGAAGGTAACCAGAAAGTGGATTAATCTTTTTACAAGGGTGTATTAATTTTTAAAGGGTTATATACAATTGAAATT

ATTCTATCCAGTCCAAGAGAAAAATCTTTTAATATTTGCATAGCATAAAAATAAAAAACAAACCTAACATTTAAGCAGTCAATTTTTAAACAATAAGTGG

AGTACTATGAGGTGTTGCTAGTATGTTTTTATGATTATGGGCTCCACAAATAGAAAACATCACTAGATCAGGGACTTGAATGCACTTTGCTTATATTGAG

TATAGAATAGGAGAGAAGAAAATGTATTTAAAGAAATATGAGAGACGACATGTGAAAGTTCTACAGGTATTGGGATGGGGTGGGATGTCTAATGTTGGTG

TTGTAGAGAAACAACATGGCTTTCTGGCACTCAAAACTCCTCATTAGCTGTTTTCTTATACCTTAAAAGTTTTAAAGTATGATTGTAAAACTAATTTTCT

TATCATATACACTGTTTTATCTCCTCAAAATAGTGAGGATAAGGCTCTACCCTAATTTCAGTGGCCCAGCTTTTATACAGAACCTCTTAGAACACCAAGT

TTCAAATCCCTGTTGGAAACTTTACTTACATTACAACTATACTTGATGGTTATCATATTTTCCTTTTATAATTAATTTGAGGAAAAATACTTACTGAGTA

ACTGTAATATAAAGGGGGGATTTTGCCCATTTAAAGTACAGGTGTAAAGCATTTAAAATGAGAGTTTTTCTAACTCAGAAATTATGAAATATTAATTTGA

ACTGAGTAGTATTAACAGTTTAAGGATCTAGCAAGAGGAAAATGGAGTCTGCTAAAAGTCTAATATTTATGTTTTAAAATATATTATTTTATAGTTATAC

TTTAAGGCATTATATCAAGTTCTTTTTATTTTCAGAATATAATTTTGAACTACCATCAGTAAATGTAAAAATGTGTGCCATGGTAAACATGTTCAAATTT

TAAATGTGACAAGTGAACTTCATGCAAATTGGCAAAAGTTCTGGTACTAAAAGTTGTATTTGTTTTTCTTTTACTTAACCTATTCAGTACTGACTCCTCT

GCCAAGAGGGTCTCCTGAGAAGACTGGGTCCTCTTGCCCTGATGTCTACTCTGTGACATGAGTGTTTTAAAGGGCTTCATGTGAACTATGGTATTATAGT

GTATGTAAGCATTCATTAAAGGGTAATAAAATATGTTTATGTACTAAAGCTGATCAGAAAAATAAGGCAGAAAAATTGATGGCATTCTTTAGATTTTAAC

TAAATGGAGCAGCTCCTTATAATACAAATTGTATAGTAAGGATACAACACTAATTAATATGTTTTCAGTTTAATTTGTTATGTATTTTTTAATTATCAAG

AAAAAGAAACAGTTTTGTACATTTGAGGATTTTTTTTTCAACAGCTTTCATCTGTATTGTCTTAACGTGGAACTTTAACACACCAGAAACGAAAGTTGTT

AAAAGCAGCCTTCTAGCACAAACACTTTTTTAAGTAAATAATGGTAGCCTAAAACTTAATATTTTTATAAAATATTGTAATATTGTTTTATGAATTATTA

AAATAAAATTCTTTGTTGAATGCA
Translation
 - UNI14684 - MGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSSTKGASVNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTG

LTG - UNI14472 - GGVTIFVALYDYEARTTEDLSFKKGERFQIINNT - UNI20781 - TEGDWWEARSIATGKSGYIPSNYVVPADSIQAEE 

EWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKG GAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE - UNI18756 

- EHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMG GTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYA

VVSEEPIYIVTEFMSKG GSLLDFLKEGDGKYLKLPQLVDMAAQ IADGMAYIERMNYIHRDLRAANILVGENLICKIADFGLARLIEDNEYTARQG - 

UNI5051 - GAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPG - UNI9273 - GMVNREVLEQVERGYRMPCPQGCPESLHELMN

LCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL

For any suggestions or comments, please send an email to unitrap@crg.es