Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000014980 (Tsen15)
Chromosomal location
Chr 1: 154217886 - 154233770 (-)
Description
tRNA splicing endonuclease 15 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1913887]
Human Ortholog
not available
Omim not available
UniTrap UNI35582
Vector Insertion
Chr 1: 154230828 - 154233771
Public Clones IST10047B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015124
Sequence
GTCTGCTTCTGGCCGAGCGGGGTTTGCGGTGCACCACGGCTTTCTGCGCGGGCGGCATGGAGGAGCGCAGCGATTCCAAACCTACCCCGGGATGTAGCGG

GCCTGGCCCGGCTCCCGTTCGCGATGGCGGCGGCGCCCACACATGGGCTCCGGAGGACGCCTGGATGGGCACACACCCTAAG - UNI35582 - TATT

TAGAAATGATGGAATTAGATATAGGAGATGCCACCCAAGTTTATATAGCATTCTTGGTTTACCTGGATCTCATGGAGA - UNI35582 - GTAAAAGT

TGGCATGAAGTAAACTGTGTAGGAATACCAGAACTACAACTCATCTGCCTCCTTGGCACTGAGATCGAAGGGGAAGGGCTGCAGACGGTGGTGCCTACAC

CCATTTCTGCTTCCCTCAGCCATAATAG GATAAGGGAAATCTTGAAGGCGTCTAGAAAGTTGCAAGGCGATCCAGAACTGCCGATGTCTTTTACTTTGG

CCATAGTGGAGTCAGATTCCACAATAGTCTATTATAAACTTACCGATGGATTTATGCTGCCAGACCCTCAG AATATTTCTCTTAGAAGATGACATCTGC

CCTTCTTGGTGCTGACTTCAGTTCTGAAAGATTGGATGTGAGGCTCCTCAGCGAGCTGCTCGTCTTTTATCTCAGAGGTAGTCAGGGCTGACTTAGCTAG

TCCCAACCCATAAACTTCCTTTCAGAATAAAGCCTTCTCCGATGGAAGCACTATATTGCTTGCAAATATAGTTAGCCTAGAACTTTCTTATCAGAGACAG

TACAGTTGCATGCGGGTTTACACCAAGGATACGTGCAGAGTTGTGGAGCCTGGCAGTGCCTCTGCCATCCCACGTAGTCGATAGACAGGTATCAGTGAGT

GGTACGGAGAAAACGCTACAGCAAGAAAACGGACACAAGAGCATTAACGTGGTCATGGGTGTGAATGACACGCCAGGCTATGAAAGTGACAATCAGATTA

CTGATAGTGGTCTCAGTAGGATGGCAGGCAGCAAGTGGATGCCTTTGTCCTTCTCCACATTTCATTTGTCATTTGTATTACTTTTATAATAAAACGGTTT

Translation
MEERSDSKPTPGCSGPGPAPVRDGGGAHTWAPEDAWMGTHPK - UNI35582 - YLEMMELDIGDATQVYIAFLVYLDLMES - UNI35582 - SK

SWHEVNCVGIPELQLICLLGTEIEGEGLQTVVPTPISASLSHNR RIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFMLPDPQ NISLRR


For any suggestions or comments, please send an email to unitrap@crg.es