Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015083 (C8g)
Chromosomal location
Chr 2: 25354176 - 25357083 (-)
Description
complement component 8, gamma polypeptide Gene [Source:MGI (curated);Acc:C8g-002]
RefSeq_dna
NM_027062 
RefSeq_peptide
NP_081338.1 
UniGene
Mm.24596 
MGI
MGI:88237 
Uniprot/SWISSPROT
Q8VCG4 
Uniprot/SPTREMBL
A2AJ34 Q9DAC2 
Human Ortholog
ENSG00000176919 (C8G)
Omim not available
UniTrap UNI33816
Vector Insertion
Chr 2: 25355613 - 25357084
Public Clones IST13156B12 (tigm) IST12286F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19894
Vector Insertion
Chr 2: 25355496 - 25355613
Public Clones not available
Private Clones OST377855 (lexicon) OST299445 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23555
Vector Insertion
Chr 2: 25355180 - 25355358
Public Clones not available
Private Clones OST253606 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040042
Sequence
CAGTTATTGCATGCATAGGGTTGAGCACTGACCACAAGTGGAAATAGGGGTGCAGAGGTCAACTCTTAACTTTGCACTTGGGACACAATGCCCAGCTCCT

ATCAAGGCTAGGTTCTAGGATGGACCCTGGCTTGGGTTAGGGGTTCAGTAATCGGAAGACAGATGTGGACTTCCTGGACTGTGCTTCCTGTGGCACTGGA

CAGTGGACTCTGACCTAGGACAGTGCACCCCTCCACCTCGCTGTCCTGTCACCTACTGTCCGTAGCAGGTTGGCCATGCTGTCTCCAGGGGCTGTGTTGT

TCTTCACCCTGCTCTTGACAGCCAGTTCGCTGGGCCAAAGGACTCGAAAGCCTATTGGGTCTACCTCCCCCATCAGCACTATCCAGGCCCAGGTCAATTT

CAGTGCTCAGAAG - UNI19894 - - UNI33816 - TTTGCAGGGACATGGCTCCTGGTGGCTGTGGGCTCTTCGTGCCGCTTTCTTCAGGAGCAG

GGACACCGAGCTGAGGCCACCACATTGCACGCAGCTCCCCAGGGTGCAGCTATGGCTGTCAGCACCTTCCGAAAGCT - UNI23555 - AGATGGGAT

ATGTTGGCAGGTACGCCAACTCTTTGAGAACACAGGGGTCCCTGGCCGCTTCTTGTTCCAAG TCTCACGGGCCCGTGGACCAGTGCATATGGTGGTTGC

TGAGACTGACTATCAGAGCTTTGCCATCCTGTACCTGGAACAGGGAAGGAAGCTGTCTGTGAAACTATACG TCCGCTCACTGCCAGTGAATGACTCTGT

CCTGGATGTGTTTGAGCGGCGAGTCAGGGAAGCCAACCTGACAGAAGATCAGATTCTTTTCTTTCCCAAGTATG GTTTCTGCGAGACTGCGGACCAATT

ACACATCCTGAACG AGGTGCCGCGATAAGGCCATCTAGTGGAGAAGCTGTGGACAGTGGGCTACCCTCAGAGAGTTCTGAGCATCCTGAATGCACTCTT

GGAGTCTCTCCTTTCTGTCCCCAGAAGCACCCCTTCATACAGCTCTGTTGTCCTAGGTCTTTTCATTAAACATCAGACTTGGC
Translation
MLSPGAVLFFTLLLTASSLGQRTRKPIGSTSPISTIQAQVNFSAQK - UNI19894 - - UNI33816 - FAGTWLLVAVGSSCRFLQEQGHRAEAT

TLHAAPQGAAMAVSTFRKL - UNI23555 - LDGICWQVRQLFENTGVPGRFLFQV VSRARGPVHMVVAETDYQSFAILYLEQGRKLSVKLYV VRS

LPVNDSVLDVFERRVREANLTEDQILFFPKYG GFCETADQLHILNE EVPR
Transcript ENSMUST00000015227
Sequence
ATGCCTTCCCCAATGCTACAGGGCACAGGGAGGCAG - UNI19894 - - UNI33816 - TTTGCAGGGACATGGCTCCTGGTGGCTGTGGGCTCTT

CGTGCCGCTTTCTTCAGGAGCAGGGACACCGAGCTGAGGCCACCACATTGCACGCAGCTCCCCAGGGTGCAGCTATGGCTGTCAGCACCTTCCGAAAGCT

 - UNI23555 - AGATGGGATATGTTGGCAGGTACGCCAACTCTTTGAGAACACAGGGGTCCCTGGCCGCTTCTTGTTCCAAG TCTCACGGGCCCGT

GGACCAGTGCATATGGTGGTTGCTGAGACTGACTATCAGAGCTTTGCCATCCTGTACCTGGAACAGGGAAGGAAGCTGTCTGTGAAACTATACG TCCGC

TCACTGCCAGTGAATGACTCTGTCCTGGATGTGTTTGAGCGGCGAGTCAGGGAAGCCAACCTGACAGAAGATCAGATTCTTTTCTTTCCCAAGTATG GT

TTCTGCGAGACTGCGGACCAATTACACATCCTGAACG AGGTGCCGCGATAAGGCCATCTAGTGGAGAAGCTGTGGACAGTGGGCTACCCTCAGAGAGTT

CTGAGCATCCTGAATGCACTCTTGGAGTCTCTCCTTTCTGTCCCCAGAAGCACCCCTTCATACAGCTCTGTTGTCCTAGGTCTTTTCATTAAACATCAGA

CTTGGC
Translation
MPSPMLQGTGRQ - UNI19894 - - UNI33816 - FAGTWLLVAVGSSCRFLQEQGHRAEATTLHAAPQGAAMAVSTFRKL - UNI23555 - L

DGICWQVRQLFENTGVPGRFLFQV VSRARGPVHMVVAETDYQSFAILYLEQGRKLSVKLYV VRSLPVNDSVLDVFERRVREANLTEDQILFFPKYG G

FCETADQLHILNE EVPR

For any suggestions or comments, please send an email to unitrap@crg.es