Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015087 (B230208H17Rik)
Chromosomal location
Chr 2: 25438539 - 25463966 (-)
Description
RIKEN cDNA B230208H17 gene Gene [Source:MGI Symbol;Acc:MGI:2442633]
Human Ortholog
not available
Omim not available
UniTrap UNI36384
Vector Insertion
Chr 2: 25457940 - 25463967
Public Clones IST10091G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058137
Sequence
CGCTGACGGGTGCCTGGCTGCCGCGCCGAGGGCCGTGGAAGCCGGAGCGGAGCCACAGAGGCTGAGGCCCCAGAACCTCGCTCGAGGCCGCGCCCGCTCC

GGCCTCGGGGGAAGCCTGGGCCGGCCGGACATGGTGCGGGGTGCGCTGTGCTGCTGCCGCTGCTGAGCTCGCAGGCCAGCCCGGCTCGCACGTCCAGCAG

GAACATGTTCTCCGCGTTGAAGAAGCTGGTGGGGTCGGAGCAGGCCCCAGGCCGGGACAAGAACATCCCCGCCGGGCTGCAGTCCATGAACCAGGCGCTG

CAGAGGCGCTTCGCTAAGGGGGTTCAGTATAACA - UNI36384 - TGAAGATTGTGATCCGGGGTGACAGGAACACGGGCAAGACAGCTCTGTGGCA

TCGACTGCAGGGCAAGAAGTTTGTGGAAGAATACATCCCCACACAGGAGATCCAGGTCACCAGCATCCATTGGAACTACAAAA - UNI36384 - CTA

CTGATGATGTAGTGAAAGTTGAAGTCTGGGATGTAGTTGACAAAG GAAAGTGTAAAAAACGAGGAGATGGCTTGAAGACGGAAAATGACCCCCAGGAG 

GCAGAGTCTGAATTGGCCCTGGATGCTGAGTTTCTGGATGTGTACAAGAACTGTAATGGAGTGGTCATGATGTTTGACATCACTAAGCAGTG GACCTTC

AATTATGTTCTCCGGGAGCTTCCCAAAGTGCCAACCCATGTGCCGGTGTGTGTGCTGGGCAACTACCGTGACATGGGCGAGCATCGAGTCATTCTACCAG

ACGATGTGCGGGACTTCATTGAGCATCTGGACAG ACCTCCAGGTTCCTCCTATTTCCGCTATGCTGAATCTTCCATGAAGAACAGCTTTGGTCTAAAGT

ACCTGCATAAGTTCTTCAACATCCCATTTTTGCAACTACAG AGGGAGACACTACTGAGGCAGCTGGAGACAAACCAACTAGACATCGATGCCACACTAG

AGGAGCTATCAGTGCAGCAGGAAACCGAGGACCAGAACTACAGCAT CTTCCTTGAAATGATGGAGGCTCGAAGTCGAGGCCACGCATCCCCTTTGGCAG

CCAATGGGCAGAGCCCATCCTCAGGCTCCCAGTCGCCAGTTGTGCCTCCAAGTGCTGTATCCACAGGGAGTTCCAGCCCCAGCACACCCCAGCCTGCCCC

TCAGCTGTCTCTAGGTGTCTCCTCCACCTGTCCCTCAGCACCATCTCCTGTACCCTCTTTGGAGGCCATGCCCTCCTCTGTACACTCTTCAGCCCCAGCC

CCAACCCCAGCTCCAGCCCCAGCTCCAGCCCAGCGTCGCAGTATCATCTCTCGGCTGTTTGGGACCTCACCAGCTGCAGAAGTGACCCCTTCACCTCCAG

 AGCCAGCTCCAGCTCTCGAAGCTCCAGCAAGAGTCCAGAATGTTGAGGATTTTGTCCCTGAAGATGGCCTTGACCGAAGCTTCCTGGAAGACACAAGTG

TGCCTAAAGACAAGAAAGTTGGAGCCAAAGGTCCCCAGCAGGATAGTGACAG TGACGATGGGGAGGCCCTAGGAGGGAACCCAATGGTGGCAGGTTTCC

AGGATGATGTGGACATAGAAGACCAGACACATGGCAAATCCCTGCTGCCCTCGGATCCCATGCCCAGTAAGAACATCAGTCTCTCAAGTGAGGAGGAAGC

CGAAGGACTGGCAGGCCACCCTAGAGTGGCCCCTCAGCAATGCTCAGAGCCTGAGACTAAATG GTCCTCCACCAAGGTCTCACATCCACAAAAGAAGAG

AGCTCCCACGAGAGGCACGCCACCGTGGTCAGATGGTCTCACCACTGATGACTCTGAAAGACCCCAGGAAGGGAAGGACAAACAGGTGTCATCAGAGAGT

GATCCTGAGGGGCCCATTGCTGCCCAGATGCTGTCCTTCGTCATGGATGACCCAGACTTTGAAAGTGATGAATCAGATACACAGAGGAGAATG GGCAGG

TTTCCAGTAAGAGAAGACCTCTCTGATGTAACTGATGAGGACACTGGCCCTGCTCAGCCACCTCCACCTTCCAAGCTCCCAGGTGCTTTCAGACTGAAGA

ATGACTCCGATCTCTTTGGGCTGGGCCTAGAGGAGATGGGACCTAAGGAAAGCAGTGACGAAG ATAGAGACAGCAAACTTCCCTCTAAGGAGAAGAAGA

AAAAGAAGAAGAAAAGCAAAGAG GAGGAAGAAAAGACTACAAAAAAGAAAAGCAAACACAAGAAGAGCAAGGACAAGGAGGAGGGCAAGGAGGATCGGA

AGAAGAAGAGGAAGCCCCCTCGGAGCAAAGAGCAGAAGGCTGCAGATGAGCTGGAAGCCTTCCTGGGGGGTGGGGCCCCTGGCAGCCGCCACCCTGGAGG

TGGGGACTATGAGGAGCTCTAAACATGCCTAGGGCAATTGATTGTCTGGGAAGAGGTGGGCTGCCAGTGGCTGGGAGGCTGCTGTCTATGCACCCACATT

CCCAGGACCACCCTGCCACCTATGTCCCCCAGCCATTATGTCTGCCCCCATGTGGTCTGGCCCACTCTACATTGTTTTTTGTGCAGAAGACCTTGGTGGT

GTTCAGGCCCTTGGGTCAGGCGCTGCAGGTGCTGGGCCTCAACCCAGCAGAAGCCTGCTCTGCAGGGAGGGAGGGGACAGAATAAAGTTGCAGCTGGCTT

GGTGGATCACCTGGCCTCCCAGAAAGAGCTGCAACCAGTCCCCGGTGTTTCTCAGGGATGTGCCTGGGGCCGAGAAGGGACCCACCAGGGTCTGTTTACA

GAGGCAGGGCGTGGGGCTGCTTGGCTTCTCTAATGCCCACCACCCAGCCCCACTCCTGCTTGCCTTCCGGGGCTCTCCCAGAGCCACAGCATGGCTTGGG

TTGTGGACCTTCTTCCCCATGGATCCAGAGTGGCACAGGGTCCTGCCCTGAGCACAGATGTGTCATGTGTCACTCAGGAGGGCATGGCAGCATCTGCTAC

TGCAAAGTGGCCCAGGCCCCGCACTGGGTAAGCCTGGCAAGAGAACACAATGTACCACTTCTCCTGTGGGAGAGGCACTAACGGGCTGCCACTGTGTGCC

AGCTGCGCCTCTGCCCGCTGAGCGCCTGCGCAGGTGAGCCCAGAGGGCACCTTCTTAGACACTCCAGACCCATACCATAAAGCTCTCTGATTTT
Translation
MFSALKKLVGSEQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNM - UNI36384 - MKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHW

NYKT - UNI36384 - TTDDVVKVEVWDVVDKG GKCKKRGDGLKTENDPQE AESELALDAEFLDVYKNCNGVVMMFDITKQW WTFNYVLRELPKV

PTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDR RPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQ RETLLRQLETNQLDIDATLEELSVQQE

TEDQNYSI IFLEMMEARSRGHASPLAANGQSPSSGSQSPVVPPSAVSTGSSSPSTPQPAPQLSLGVSSTCPSAPSPVPSLEAMPSSVHSSAPAPTPAPA

PAPAQRRSIISRLFGTSPAAEVTPSPPE EPAPALEAPARVQNVEDFVPEDGLDRSFLEDTSVPKDKKVGAKGPQQDSDS SDDGEALGGNPMVAGFQDD

VDIEDQTHGKSLLPSDPMPSKNISLSSEEEAEGLAGHPRVAPQQCSEPETKW WSSTKVSHPQKKRAPTRGTPPWSDGLTTDDSERPQEGKDKQVSSESD

PEGPIAAQMLSFVMDDPDFESDESDTQRRM GRFPVREDLSDVTDEDTGPAQPPPPSKLPGAFRLKNDSDLFGLGLEEMGPKESSDED DRDSKLPSKEK

KKKKKKSKE EEEKTTKKKSKHKKSKDKEEGKEDRKKKRKPPRSKEQKAADELEAFLGGGAPGSRHPGGGDYEEL

For any suggestions or comments, please send an email to unitrap@crg.es