Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015305 (Sash1)
Chromosomal location
Chr 10: 8442017 - 8605868 (-)
Description
SAM and SH3 domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1917347]
RefSeq_dna
NM_175155 
RefSeq_peptide
NP_780364.3 
UniGene
Mm.338275 Mm.474760 
MGI
MGI:1917347 
Uniprot/SWISSPROT
P59808 
Uniprot/SPTREMBL
Q6ZQ46 Q8BRY6 
Human Ortholog
ENSG00000111961 (SASH1)
Omim not available
UniTrap UNI2765
Vector Insertion
Chr 10: 8570290 - 8605521
Public Clones AK0040 (sanger) (ggtc) CMHD-GT_285G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7414
Vector Insertion
Chr 10: 8534256 - 8570160
Public Clones (sanger) RRS736 (baygenomics) FHCRC-GT-S2-5C1 (fhcrc)
Private Clones OST434325 (lexicon) OST103607 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI844
Vector Insertion
Chr 10: 8476560 - 8500316
Public Clones CF0734 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1599
Vector Insertion
Chr 10: 8460182 - 8461225
Public Clones CC0006 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI689
Vector Insertion
Chr 10: 8453508 - 8459118
Public Clones DC0193 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015449
Sequence
GGAAAAGTTTCTGGAGTTGTCAATCGCGGTCGCCCGGGATCGAGGTGCCAGTCCTGGCAGTGGTGCTCGTACCCAGCGGAGCCTGGGGCATGCGACGCGG

GGGCGCGGCCCGGTGACGCCGCGGGCGGGGAACTTGCGCCCCGTCGGCCGACGCGCTGCTGCGAGCGGTGGGCAGCGCGGGGACCCGGACGCGGACGCAC

GGGGACGCGGCCATGGAGGAGGACGCGGGAGCTGCTAGCCCGGCGCCGGAGCCTGAGCCGGAGGTGGATCCCGCCCGGGAGCTGGAGCCCGAGGCCGGTG

TCTCCGAGTCAATCTCCCGCCTCTGGACCGACGTGATGGGCATCCTG - UNI2765 - GATGGTTCCCTGGGAAACATTGATGACCTGGCACAGCAGT

ATGCAGATTATTACAATACCTGCTTTTCTGACGTGTGTGAGCGGATGGAGGAGCTCCGGAAACGGCGCGTTTCCCAGGACCTGGATGTG - UNI7414 

- GAGAAACCCGACGCCAGCCCCACGTCACTTCAGCTGCGGTCCCAGATCGAA GAGTCTCTAGGCTTCTGCAGCGCCGTGTCAACACCAGAAGTGGAAA

GAAA GTACCCTCTCCATAAATCAAACTCAGAAGACGGCTGTGTAG GCAAAGGAGATTGGAAGAAGAAAAATAAATACTTCTGGCAGAATTTCCGAAAG

AACCAAAAAGGAATAATGAGACAGACTTCAAAAG GAGAAGATGTGGGCTATGTAGCCAGCGAGATTACGATGAGTGACGAGGAGCGGATTCAGCTGATG

ATGATGGTCAAGGAGAAAATGATCACCATTGAAGAAGCGCTCGCCAGG CTGAAGGAATACGAGGCCCAGCACCGTCAGTCATCCACCTTGGACCCCGCA

GACTGGCCCGATGGCTCCTACCCGACATTGGATGGCTCCTCCACCTGCAAC - UNI844 - TCAAGAGAGCAGTCGGATGATGAGACAGAGGACTCGG

TGAAGTTTAAGAGGTTGCACAAGCTGGTAAACTCTACTCGAAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAGCCCAGCACAGAAG GTG

GAGAGGAACATGTATTTGAGAATTCCCCAGTCCAAGATGAAAGATCTGCACTCTACTCTGGAGTGCACAAAAAGCCATTTTTCTATGATGGCTCTCCTGA

GAAACCTCCAGAAGATGATGCAGACTCTCTCACCCCATCTCCATCATCCAGCAGCCTGGATACGTGGGGAGCTGGCCGGAAGTTGGTCAAAACCTTCAGC

AAAGGAGAGAGTCGGGGCCTGATTAAGCCCCCTAAGAAGATGGGGACATTCTTCTCCTATCCAGAAGAAGAGAAGGCCCAGAAAGTGTCCCGCTCCCTCA

CAGAGGGGGAAATGAAGAAAGGTCTTGGGTCTTTGAGTCACGGG AGAACCTGCAGTTTTGGTGGATTCGACCTGACAAACCGTTCTCTGCATGTTGGCA

GTAATAATTCTGACCCTGCG GGTAAAGAGGGAGATTTTGTGTACAAAGAAGTCATCAAATCCCCTCCTGCCCCCCGCATCTCTCTCGGGAAAAAGGTGA

GATCAGTGAAAGAGACCATGAGGAAGAGGATGTCTAAAAAGTACAGCAGCCCGGTCTCAGAGCAG GACTCGGGGCTCGATGGAATGCCCAGCTCCCCCG

CCTCAGGAAAGCCTGACTCCGAACACGTGGACAAGCCTAAGCTCAAAGCCGGGGGCTCTGTGGAAAGCCTTCGGAGTTCTCTGAGTGGCCAGAGCTCAAT

GA GTGGTCAGACAGTGAGCACCACTGATTCCTCCACCAGCAACCGGGAGAGTGTCAAGTCAGAAGATGGGGATGACGAAGAGCCACCCTATCGGGGTCC

CTTCTGTGGGCGTGCCCGAGTGCACACTGACTTCACCCCCAGTCCCTATGACACGGACTCTCTGAAGCTCAAG - UNI1599 - AAAGGAGATATCAT

TGACATAATTAGCAAACCACCCATGGGTACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGATGTGCTAAATGAGGAA

GAGGAGAAGCCCAAGCGCCCTACCAGGAGGAGGAAGAAGGGAAGACCATCTCAGCCGAAGTCTGTGGAGGATCTCCTGGACCGGATCAACCTGAAA GAA

CACATGCCCACCTTCCTGTTCAATGGCTATGAAGACCTGGACACCTTCAAACTCCTGGAGGAAGAAGACTTAGATGAATTAAATATCAGGGACCCAGAAC

ACAGAGCAGTTCTTCTGACTGCGGTGGAGCTGTTGCAGGAATATGACA - UNI689 - GTAACAGTGACCAGTCCGGTTCTCAGGAAAAGCTGCTGGT

GGACAACCAGGGCCTGAGTGGACGATCCCCACGAGACTCCGGATGCTACGAAAGCAGCGAGAACTTGGAAAACG CCAAAACTCACAAACCCAGCGTTCT

GTCTACCAAGTCGTCCACGGAGTCCAACTTAAAGTCTTTCACCAGGAGTCAGCCAGGCAACTACCCGACATTGCCTTTAATGAAATCAGGGGAGGTGCGC

AAGCAGGGAGAGGAGGGCAGGCTGGGACGAGGTCTAGCCCCGGACACTGCCAAGAGCTGTGACGTGCCCTCTGTGACTGATTTGAGTAAAAACCGAAGGA

GCCTCCCGGTCTCCATCTGTCGCAGCTGTGAAACCCTGGAGGGTCCTGAGCCTGTGGAAAGTTGGCCCCGATCCCATTCCCTGGATGACCTTCAGGGAGA

TGCTGATGTTGGCAAGAATGTGCCTACCGAGATGCCAGAAACCTGTTCTCAGAATGTACCAGAAGTGCCGCAGAAGACGTCTGCCTGCACCTCCAAGGCT

CTGCCACGAGGCCGAGATCCCACAGCAGATGTGATGCTTCTGACCCAAAGCAAGAGATTTTCCGACCCCCCGAAAACAATGGCTAAGAAACTGGATGGCT

CCGTGGTGGCCTCCAACCTTGGGATAGCTCCTCCTCAGTGTATACCCAGAGATTTCGAGGCCCAGCCGCCTGTTAAACCCGGCTTAACAAGGACGTCTCT

TGAGGGTCTCAGAAAAGGACATGATCACCACCCCCTGGGCACCAAAGAAGGGGTAGACGGGGAGCAGAGCGCCCCTGAGACCAGGACACAGTCCCGACAT

CCGTCGCAGCCCCCTCCTGTGCCAGCCAAGAAAAGCCGAGAGCGCCTGGCCAATGGCCTGCACTTGGTCCCCAGCCCAGAGGCACCCATCCTGCCACTGA

AGAAAGCCAGCCCTGCCAGCCCAGTCAGTCCCAGCGACTGCCCCTCTCCCCGGGAACCCAGGCCTTCCTCCGGGACTGAGCCGGGCAGCCCAGCCTGTAC

GAGACCTCCACCCTGGCTGGCTGAGCTGCCCGAGAGCACTAGCCTGCAGGAGCATGGTGTGAAACTGGGCCCAGTGCTGAGCAGGAAGGTTTCCTGTGTC

CGGGGTGTGGACCTAGAGATGCTCACGGAGAACAAGCTGCAGGCGGAGGGCATTGATCTCACTGAGGAGCCCTACTCTGATAAG CATGGCCGTTGTGGG

ATCCCGGAAGCCCTGGTACAGAGATACGCAGAGGACCTAGAGCAGCCTGAGAGGGATGTTGCCACCAACATGGACCAGATCCGGGTGAAGCTGCTTCGGA

AGCAACATCGGATGGCG ATCCCGAGTGGTGGGCTGACGGAAATCTGCAGAAAGCCCCTCTCTCCCGGCTGTGTTGCGTCCATGTCGGATTGGCTCATCT

CTATCGGCCTGCCCATGTACACGAGCACCCTTTCTGACGCAGGGTTCAGCACGCTGAGCCAAGTGCCTTCCCTGTCCCACTCTTGCCTTCAGGAGGCCGG

CATCACCGAGGAGAGACACATAAGGAAACTCATAACGGCAGCCAGACTCTTCAAACTGCCACCAAGCCCTGAGGCTATGTAGCCAGGCCGGCGTGGCCCT

CCCTAGACAAGAGCCAGCCTCTCACTGTGCTTAGGAAGCCGATACAATCCCTCCACGTCTGCTGGGGTTGAAGAAAAGTATTCTCTCGGGGCTCACGAAC

TGCAGGATTGGGACTCAGAACCGAGGCCCCTCTCTTCCGGTAAAGCCCTCCTCCCCTGCCCCTCGAGGAAATCGAGGTGATTCTCTTTGATGCCCAAAGG

CAAGACACGCACTTAGTTCCGTTTTCAGGCACTGAAGAGCCAAGACACTACAAACAGTGTGTGTCCAGTCTGTCTTTGTGCTGTCAGAGGGCTAGGAGGA

CGAGGCAGCCGGCTCGTGTCTGATCGTGCCCTTGCGCATCTGTTGGTCACCCGATGCCCGAGCCCGATGGGCTTAGCTAGGCCAAAGCAACAGACTCTGG

AGTTACTGTATACTATTGACCATGCTCATTTGTTCAAAAGCTACAACAGCTGACTCTATCAAGAACAGAACGGTCCTCCTCTCCTGTAGATAAACGACCA

GAGACATTTTAATTGCTTTCTAGCAATTAGCTTTTATTTGCCTTAATATAAACTTTTAACCAGTTATCTATCTAGTGTCCACAGCCCTTACTTAACCCTA

GTTCCAGATTTTCAGCTTAGACTGCCATCTAACGTGTTTGGGATGTTTCCAGCAAAAATAGCCTTTTTTTTTAAAAAAACAGTCTCATTCTAACATGGCT

TATTTTATAAGGGTGACTACCAGGCACACGTTTCATGTTGACTTTTAGTTTTTGAACTAACTATAATTTAGTAAAAGTCGATCGGGACTCACAGAGGGGC

ACGTGTGTGTGTAGTGACTGCCCTTCAGTCTTCTGCCTTTAGTGAGAGGCTGTCACAGTGGCCATGGTGTTGTGAGTGGCTGTCACGGTGGCCATGGTGT

TGTGAGTGGCTGTCACGGTGGCCATGGTGTTGTGAGTGGCTGTCACGGTGGCCATGGTGTTGTGAGAGGCTGTCACGGTGGCCATGGTGTTGTGAGAGGC

TGTCACAGTGGCCATGGTGTTGTGAGTGGCTGTCACGGTGGCCATGGTGTTGCAGTATTTATGTGAAATCCTAACCTCATCCATCCCCAAATCCATTCAT

CAACTATCAGATCACCTTTGCAGAAAGCCATTGTAAGTTGCATATTTCAGAAAGATTTTTTTTTCTAAAAAGGGAAGTAGTTTACTCATTTAAAGTTCTT

TTTGTTTGTTTGTTTTTAATTTTTTTTCCATTTTGGCCGGTTTTATTATCTCTCATTTGTTATGTAGATAATTATTTTAATTCAAGCAAAGGTTCATTAT

GGAGCCAGATAAACCACATCCGCTGGGTGTTAAATATTGCATATTTTCAACTGGTTTTTCCAACTTTGATTTCCATGTGATCTGCCCTCTTTTTGTCTGG

CGTCTGGTTTTCTAGCAGTTGGCACACTTAGACAGGTGTGCCTGATCCATTGCTTACAAAGTGTTTTTTCTTCATATTCTTGCAAGCACGATGTGAAGTC

TCCAGTTATCGTGGAAGCATTTTGAATACAAGGCCCGGATCAGTCCTCCGCTAGTTCATTTGGGTTATTACAATTTGATTCCCCTCAGAAGAGAAGGGCA

AGCGGTTTTATGAATAACAACGCCATCCTGGCCTTATGGTTTATATAGCTGGTCCACGTCTCTGAGGAACATCTCAGGTGATTCCCCCCACCCCACACAC

ATTTTAGTGTGCGCTAAAAAATAATAATATTGCTTGGTTTCCTCACTTCCCTTCGCCTACTATAAAATGCCACGTGGAGAAGTTGAGGCAGTTTAGAATG

AGAAGAGTAAAGGCACTGGGTTCCTATTGGACTCTTAATAAAGAGCTCACGGTTAGCTTCCAGGGTCAGGCATAGGCCACCCAATGGGTGGGGGTGCAGG

GTTCTCTGCCAGTCCAGGACCCAGTCACATGCTGTTGTGGGGGTTGGCATTGGAAAACAGGCTTCTTCTCTTGCTTTTGAAGTAACCCTGGCCTGACCGT

GCAACAGACTGCCCTTTGATTTTAGCTGAGCGAAGAGAGAGAGACCTCGCAAAAGTAACATCGGAGGTAACCAGGGAGGAGGAGAAATCTTTTGGGAATT

TCCAAGTTTCAGTTCATTCTTGGTGTAGGGTTTTCTGTTTTAAGTCAATCAAGGAGGTCTTGAGAATGTCAAACAGTAGCTTTTTTCTCTCTGGAAATTG

TCGCCTTTGCATGGAGAATTAAATTCAGGGACCACGAGTTTAGTGTGAATGTCTGATCTGAAGGGGCTGAGGCTTCTTATCCCTCCCTCCCTCCCTCCCT

CCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTTCCTTTCCTTTCCTTGTATCATATTTGTTTGGTTTTCTTTTGCTTTGAACGTTTCATTTGGTCTGAGA

AAAGCCTGAACATTAGCGTATGACTCTGAGGAGACTCGGGGCTGCCTGTGGCTGTTAGCGGACAGGCGGCCGGCTTTAGCAATAGCCACTTTTGATCGGT

TGCATTTGGTACAGAATTTTGAATGACAGTGAAAATTGTTGTCTTTGCAAAGCACAAAACTAACCTGGAAAGGCGTTTCGGCTCAGGTAGCTACCCAGAA

TGTGTGTGATTGGTGTGTCTCCGCTGTCTGCAGAGAAAGCAGCTGCCCAAACTACTATTTACATTCCCAGATACTGAGAGCAAATAGCTTTTCATGGCCT

TGCATATTTGGGGGCCCTTTTCTCTGTCCCGACCCCAGGTGCGGATGGAACTAGAAATGATTCTTCTGTGAGAAAAGAGTCCTGGACACGGAGTAGTGTG

TTTCACAACTGCGGTGGAACACAAGTAGATTCCCAAGTCACTGCTGTGTGAGGACTGAGTGAGGTTCCCGAAAAATTCTGTCTTGAGTCCATGTTATCTT

GATTTTTAAAATTGATAGGGAAGAAACCCCACAAACTGTCAAGCAAGTTATATGACAACTAACAACATTGCACTTTCTGTATATGAAATCAATATTTAAA

TAACTTATTTTTCTCCATTGCTATTCTTAAACATTGTAAGTAGCTGTAATATACCAATACCAATACGTTCTTGCAATTGCTTCAGCCCGAGAAAGCTGTG

TATTGTTTTAAAATTGTAAAAAAAAAAAAAAATATTGTGATGATCCATTTAAAAAAAAAAAAAAGGAAGGTAGACAGAAGGGTTTTCCTGTGTATCAAAA

CTTGTCTATAATTATGTCACCTATGTACCTAGGGGAAAGGTAAATAAAATGTCTTCATCG
Translation
MEEDAGAASPAPEPEPEVDPARELEPEAGVSESISRLWTDVMGIL - UNI2765 - DGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLD

V - UNI7414 - EKPDASPTSLQLRSQIE ESLGFCSAVSTPEVERK KYPLHKSNSEDGCVG GKGDWKKKNKYFWQNFRKNQKGIMRQTSKG GED

VGYVASEITMSDEERIQLMMMVKEKMITIEEALAR LKEYEAQHRQSSTLDPADWPDGSYPTLDGSSTCN - UNI844 - SREQSDDETEDSVKFKRL

HKLVNSTRRVRKKLIRVEEMKKPSTEG GGEEHVFENSPVQDERSALYSGVHKKPFFYDGSPEKPPEDDADSLTPSPSSSSLDTWGAGRKLVKTFSKGES

RGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHG RTCSFGGFDLTNRSLHVGSNNSDPA GKEGDFVYKEVIKSPPAPRISLGKKVRSV

KETMRKRMSKKYSSPVSEQ DSGLDGMPSSPASGKPDSEHVDKPKLKAGGSVESLRSSLSGQSSMS SGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGP

FCGRARVHTDFTPSPYDTDSLKLK - UNI1599 - KGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPTRRRKKGRPSQPKSVEDL

LDRINLK EHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDS - UNI689 - SNSDQSGSQEKLLVDNQGLSGRSPRDSGC

YESSENLENA AKTHKPSVLSTKSSTESNLKSFTRSQPGNYPTLPLMKSGEVRKQGEEGRLGRGLAPDTAKSCDVPSVTDLSKNRRSLPVSICRSCETLE

GPEPVESWPRSHSLDDLQGDADVGKNVPTEMPETCSQNVPEVPQKTSACTSKALPRGRDPTADVMLLTQSKRFSDPPKTMAKKLDGSVVASNLGIAPPQC

IPRDFEAQPPVKPGLTRTSLEGLRKGHDHHPLGTKEGVDGEQSAPETRTQSRHPSQPPPVPAKKSRERLANGLHLVPSPEAPILPLKKASPASPVSPSDC

PSPREPRPSSGTEPGSPACTRPPPWLAELPESTSLQEHGVKLGPVLSRKVSCVRGVDLEMLTENKLQAEGIDLTEEPYSDK HGRCGIPEALVQRYAEDL

EQPERDVATNMDQIRVKLLRKQHRMA IPSGGLTEICRKPLSPGCVASMSDWLISIGLPMYTSTLSDAGFSTLSQVPSLSHSCLQEAGITEERHIRKLIT

AARLFKLPPSPEAM

For any suggestions or comments, please send an email to unitrap@crg.es