Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015340 (Cybb)
Chromosomal location
Chr X: 9013154 - 9046417 (-)
Description
cytochrome b-245, beta polypeptide Gene [Source:MGI (curated);Acc:Cybb-001]
RefSeq_dna
NM_007807 
RefSeq_peptide
NP_031833.3 
UniGene
Mm.200362 Mm.474696 
MGI
MGI:88574 
Uniprot/SWISSPROT
Q61093 
Uniprot/SPTREMBL
Q3TVP4 Q3U4P0 Q3U6G0 Q3U6M7 Q8C6S5 
Human Ortholog
ENSG00000165168 (CYBB)
Omim 306400 - GRANULOMATOUS DISEASE, CHRONIC, X-LINKED  
UniTrap UNI31119
Vector Insertion
Chr X: 9021673 - 9024073
Public Clones IST12018E7 (tigm) IST12050E7 (tigm) IST14502D2 (tigm) IST11690B8 (tigm)
IST13235C7 (tigm) IST11089F11 (tigm) IST11731B9 (tigm) IST10744A5 (tigm)
IST12477H2 (tigm) IST14645B7 (tigm) IST10616C4 (tigm) IST14294E1 (tigm)
IST14561B4 (tigm) IST14573C12 (tigm) IST14344E11 (tigm) IST14708A2 (tigm)
IST14258D10 (tigm) IST12068A6 (tigm) IST14271E9 (tigm) IST14431C6 (tigm)
IST10851G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015484
Sequence
GTAGAGAAGAGAGGCAGAACCAACACTTAACCTTTGCTAACATGGGGAACTGGGCTGTGAATGAAGGACTCTCCATCTTTGTCATT CTGGTGTGGTTGG

GGCTGAATGTCTTCCTCTTTATCAACTACTACAAGGTTTATGATGATGGGCCTAAGTATAATTATACTCGAAAACTCCTTGGG TCAGCACTGGCTCTGG

CCCGGGCACCTGCAGCCTGCCTGAATTTCAACTGTATGCTGATCCTGCTGCCAGTGTGTCGAAATCTGCTCTCCTTTCTCAGGGGTTCCAGTGCG TGTT

GCTCGACAAGGATTCGAAGACAACTGGACAGGAACCTCACTTTCCATAAGATGGTAGCTTGGATGATAGCACTGCACACCG CCATCCACACAATTGCAC

ATCTCTTCAACGTTGAGTGGTGTGTGAATGCCAGAGTCGGGATTTCTGACCGGTATTCAATAGCTCTCTCTGACATCGGTGACAATGAGAACGAAGAGTA

TCTCAATTTTGCTAGAGAAAAAATCAAG AACCCTGAAGGGGGCCTGTATGTGGCCGTGACTCGGTTGGCTGGGATCACAGGAATTGTCATCACACTGTG

TCTCATATTGATTATCACATCCTCTACCAAAACCATTCGGAGGTCTTATTTTGAAGTGTTCTGGTATACACACCATCTCTTTGTGATCTTCTTCATCGGC

CTTGCCATCCATGGAGCTGA ACGAATTGTACGTGGACAGACTGCGGAGAGTTTGGAAGAGCATAATTTAGATATCTGTGCAGACAAAATCGAAGAATGG

GGAAAAATAAAGGAGTGCCCAGTACCAAAGTTCGCTGGAAACCCTCCTATG ACTTGGAAATGGATAGTGGGTCCTATGTTCCTGTACCTTTGTGAGAGG

TTGGTTCGGTTTTGGCGATCTCAGCAAAAGGTGGTCATCACCAAG - UNI31119 - GTGGTCACCCACCCTTTCAAAACCATTGAGCTTCAGATGAA

GAAGAAGGGATTCAAGATGGAGGTGGGACAGTACATTTTTGTCAAGTGCCCCAAGGTATCCAAGTTAGAATGGCACCCATTCACACTGACCTCTGCTCCT

GAGGAAGACTTTTTTAGCATCCATATCCGTATTGTGGGAGACTGGACGGAGGGGCTATTCAATGCTTGTGGCTGTGATAAGCAGGAGTTCCAAGATGCCT

GGAAACTACCTAA - UNI31119 - GATAGCAGTTGATGGACCCTTTGGTACAGCCAGTGAAGATGTGTTCAGCTATGAGGTGGTGATGTTAGTGGGA

GCCGGGATTGGAGTCACGCCCTTTGCCTCCATTCTCAAGTCTGTCTGGTACAAATATTGTGATAATGCCACCAGTCTGAAACTCAAAAAG - UNI3111

9 - ATCTACTTCTACTGGCTGTGCAGGGACACGCATGCCTTTGAGTGGTTTGCAGACCTGCTGCAGCTGCTGGAGACCCAGATGCAGGAAAGGAACAAT

GCCAACTTCCTCAGCTACAATATCTACCTTACTGGCTGGGATGAATCTCAG GCCAATCACTTTGCTGTGCACCATGATGAGGAGAAAGATGTGATCACA

GGCCTAAAACAGAAGACTCTGTATGGACGGCCCAACTGGGATAACGAGTTCAAGACCATTGCAAGTGAACACCCTAA CACCACAATAGGCGTTTTCCTG

TGTGGCCCTGAAGCCTTGGCTGAAACTCTCAGTAAACAGAGCATCTCCAACTCAGAATCCGGCCCGCGTGGAGTCCACTTCATTTTCAACAAGGAAAACT

TCTAACTCCGCTCTTTCACCAGGAAACCAGTGTATGCTGCCAAATGTCCCAGTAATGCTGGTTGGTTGTAGGAGAGAAGGAGGAAAGGAAATCACAATGA

CACAGGCCCCCTAAAAGGAATTCCAAAGATCCTTACTAGTCATCTGTCATATTGCATGGAACTTCATGGTTTCAGAGCACTTTTTACATACATAGTTATG

CATTGTTTCACATTTCCCTTTGACATGCCAGAAGAGGGTAAGGCAAAAGCATTTTCTGGGACTCTCTCTAGGATAAACAATAGGATCTCAAATGAGTTCC

ACACCTTCCTTCCAATTCAGAAGTTGAAACCACACCTAAGCCATCTGACTCTGGGTGTGGTCACCTTTTCACCTTTAATACCAGGTTGTCTCAAGCCTCA

GTTTTTATACTATCCACCAACAAAAAAGCAAGTCAAAGAAGAGCTCATCATTCTTAGCTGTTGTTTTCTCTTTAACCTTAGCATCATGCTAAAGGAAACT

TTTTAAATAGAGGAGATAGTGATGCTGATGGTGACTTAATACTTCCTAAATGACAGTATCGGCACAGAAGTATATTCCAGTTTTATCAGCACAACAGTTT

AACTGGGTCAGAGATTATTCCTAGTAAGAAATATTAGACTGATTGGAGTTAAAGTAGCACTCTACATTTACCATGGTGTTTGGCAGAATTGGTGTTCAAG

GTCAGTTTATTGAATGAATGAATGAATGATTGAACAAATAGATGCAAACATTCAGAACTATATCATAATGGAATGTATGGCCAGAGACAGAATTACCCTT

CTGTTTCTTTTACACACCAAAGTATCCTGATTCCCCTGGGAGTAGAGAGAAAGATATGAACCAATAGGGAGAGTCAGGCCATTCTACTGGTATTCATCCA

ACTGTCATTTGAAGGGAGGAGGCATGAATTCAGAGACCTATTCTCCTATGATGATGGTGGCTAACACTTCTAGTTCCAGTCTGTAAGCTGAAAAAGAAGA

ACACATTTATTTACTGACAGAAATGATCTGCTCCAGCCAAACTTTGAACTGAATTCTAAGAAATGTATACATGATAATACATATCCTGCTTAGAATCCAT

TTCTTCTTTGGCTTAAATACCTATACAAATAGATCTTATGTGCATAGACAATAACTTGTTTTTTTTTTTTTAATTGCAGCATTTTCATCACCACTAGTAC

CAGCATCACCATCTTCCTAAAATATAAATTTTAGAAACTGTAATCCCCAAATAACTGGGTTAAGAGTAAAATCACATCCGATATTTTATGGGCATCCAGA

AATGCAAGACAGAGTCTAGATGACTGCTAGACTAGTCACATGTGAAAAAAAAAAAAAAAAAGAGAAAACTACTCCTCTTTCTGGGAACTAAAAGCATTTC

TGACTGCCCCCCCCCCCCCAGGAATACAAAGACTTATAACTATTCAGCTTTGGTAATGAGGAAGGAAGAGTAGAGAGCAGAGGCCTTGATGGAGAGAAAG

TGGTGAAGCCAACAGGAGAGAAAGGAAAGCACCACACTCACAAGGGAAGTGTCAGAGGCAAAGGGTCTCATGGTGGTTAGGATTCGGCCTCCATTGCTAC

TTGATATGTATCACATGTAACTAAAGGACGCATGCGCTCATCTTGTTTTGACTTCATATTGCATTGCATAGTTTTAGTTCTGATCACAAATTTTGCTATT

GTATGAAGATTTTGAAGGGACTAGACGAAGGGAGAGCTCAGATTCTCCTTATGTTCCTGCTATGCTCTTGTTCGCTTAGCATCCTTAGAGCACTCAAGGC

TGGTTCTGGTAAATAAGGCCTTCCTAGATGTGCACATGGTACCAGGAGAATTGTTGCCCTGGGACAAAGGTCCAGACAGACCTTCGTGTTGCACCCTAGG

CATTAGGTCATTCATTCAACATACATTTGTTTGGTATAATTAATGAGTCAATTTTAACTATTTGTGGCAAAGTTTGATCTCAGTTACAAGGACTCTGAAA

ACACCGTGTTCTAACAAAAGTGGTAATGAGTCTGTTTGTTGCTACAAGAATCCTTCTCCAGTTTTCTGGGGTTTTCCTTGTCTTTATTTTTCTTGCAGAC

AATAGATCCAGACTGCAGACTGGCCCCTCTCCCTCTCCCAGCCCTGCCTCCACACCTCCTCTTCCCCAGATCCATTGTTCCTCTGTTTCCCTTC
Translation
MGNWAVNEGLSIFVI LVWLGLNVFLFINYYKVYDDGPKYNYTRKLLG SALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSA CCSTRIRRQLDRN

LTFHKMVAWMIALHTA AIHTIAHLFNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIK NPEGGLYVAVTRLAGITGIVITLCLILIITSST

KTIRRSYFEVFWYTHHLFVIFFIGLAIHGAE ERIVRGQTAESLEEHNLDICADKIEEWGKIKECPVPKFAGNPPM TWKWIVGPMFLYLCERLVRFWRS

QQKVVITK - UNI31119 - VVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQ

DAWKLPK - UNI31119 - KIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCDNATSLKLKK - UNI31119 - IYFYWLCRDT

HAFEWFADLLQLLETQMQERNNANFLSYNIYLTGWDESQ ANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPN NTTIGVFLCGPEALAET

LSKQSISNSESGPRGVHFIFNKENF

For any suggestions or comments, please send an email to unitrap@crg.es