Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015341 (Golga7)
Chromosomal location
Chr 8: 24351825 - 24367546 (-)
Description
golgi autoantigen, golgin subfamily a, 7 Gene [Source:MGI (curated);Acc:Golga7-001]
RefSeq_dna
NM_001042484 NM_020585 
RefSeq_peptide
NP_065610.2 NP_001035949.1 
UniGene
Mm.327543 Mm.469654 
MGI
MGI:1931029 
Uniprot/SWISSPROT
Q91W53 
Human Ortholog
ENSG00000147533 (GOLGA7)
Omim not available
UniTrap UNI27763
Vector Insertion
Chr 8: 24356437 - 24360720
Public Clones not available
Private Clones OST50083 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121783
Sequence
GGGTTTGTGTTTCCAGGGCCGAACCAGGATGTGGGGGGGCGCGGGTCCTGGGCTTGGGTAGCTTGGAGTCCCTCGGCTACAGCCATGAGTGAAGGGGATC

GGCGAGGGGGGAGGCCTGGGGCGTCTTTGGGCGGTGGGTGGCTCCGAAGGGCTGGCGGGCCGGAGAGCCGGCTCTAGGCCGGCCATCTGACCCCGTGTCT

TGCCCGAACTCGCAGAGCGGCGGGTCCTGTCCTCGCCATGAGGCCGCAGCAGGCACCGGTGTCCGGGAAGGTGTTCATTCAGCGAGACTACAGCAGCGGC

ACGCGCTGCCAGTTCCAGACCAAGTTCCCCGCGGAGCTGGAGAACAGG ATTGACAGACAGCAGTTTGAAGAAACAGTTCGAACTCTAAATAATCTTTAT

GCAGAAGCAGAGAAACTTGGGGGCCAGTCGTATCTTGAAGGCTGTTTGGCTTGTTTAACAGCATACACCATCTTCTTATGCATGGAAACTCATTATGAGA

AG - UNI27763 - GTCTTGAAGAAAGTCTCCAAATACATTCAAGAACAGAATGAGAAGATATATGCTCCCCAAGGCCTCCTCCTAACAGACCCCATT

GAGAGAGGACTTCGAGTT ATTGAAATCACCATCTATGAAGACAGAGGTGTGAGCAGTGGAAGATAAACCACAGAGTTACAG GTCCTGCCTCCAGCTGG

GACCTTCGTCTATCCACTGGCCGATGGCAGAGTGTCCCTACCTCCTCTCCAGAGCGTTATTCTCTTGTCTCTGCTGCCAGAGCCACGGTGCCACACCTGG

AGTGACCGCTCGTCACTCAGCATCCACTTTGTCTCCCAGTTGTGTAGGACTCTGTGATCTTTTGATTTGTTTCCAAGAAAATAAAGGAAGCAATTCTCTT

TATAAATTCAAAGCCATTTAAAACACAGGCAGTTGGCCAGCCCAAGACAGAGTCGTTTTCTTACCAGATACCAGTGTCACTGGTTCTCCTTGTCCCTTGG

GTCAGTTTCCTAGGTGGCTTTATGATCCCACAAGTCATGTCTTAGCTCAGTCCCTCCCCCAGATTAGTAGCAGGCTTTGAGGGTGTGTGTGCCTGTGGTC

CGGCTGACCCGCCGCCCGAGTCCCCAAGCTACCAGCCTTGACGTGCTTCAGATCTTCAGATTGGTTTCTGCTGTTCAATTTCAGAGGCTCCTTGAGAGAA

TAATATATGTTACTTGTTTTAGTGTTGCAGTTATTATTAAGGCAGTATTTATGCAATTCCGGTTGTTTCTTTGAAAGCAGTTCTGTTAATGTGCATTACC

TCGAGATGTTGGGGAGATGTTGTGTGTGTTGCTTGTTCATTCCACAGATAAGTAAGCACAATGAGCAGACCCTCAGCCATCAGCTCCACCTGCCCCAGCT

CTGCCCGGTGTGGAAGAAGCAAGTGTCCTAAGCACCTAACTCTAGTTTTGTTACAAGTATAACTTAGGAGAAAAAATTGGTAGAAATAATACAGTATGTT

GCTAATTTGTAACCTACTTTAAACTCTGATTTATAGCCTCACATACAGTATTCAGGGCACAGAAATCTTTTGATTGACTCAAGTAAGTTTTGGCTTCCGT

GTAACTTCAAGTTAAAGTTAATTTTTTTCAGCTCTTCTTTATCTCTATACTCTCTTAGTATCGGAATTTCTTATGTTCTTTTAGGAATTTGAGAGCACTG

TGTTTGGGAGAAGTTAGGAAACATAAGGAATGAATGAAGCAGTTGAACTTGGAGATACTGTAGGTGCTAATACTGGATCTAATCTTTCAGATTTAATTTG

TTTTCTGGGCCTTGTAGTTACTCAGTAAACCCCTTAGATCTGTGTAATAATTTAATTGTATAACGCTCATTTGTTCCTTTAAAGCCTATTCTAGTCTGTC

TGCCTTTTAAACTTGTTGCAATAATGTCGCCAAGATATAAACACATTAGTAAAACTTTTCTT
Translation
MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENR IDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEK - UNI27763

 - VLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRV IEITIYEDRGVSSGR 
Transcript ENSMUST00000051094
Sequence
GGACGTAAGCGGCGACGGAGGTGGCGCGACAGCTGCTGGAGGGCCGAGGAGGCGG AGCGGCGGGTCCTGTCCTCGCCATGAGGCCGCAGCAGGCACCGG

TGTCCGGGAAGGTGTTCATTCAGCGAGACTACAGCAGCGGCACGCGCTGCCAGTTCCAGACCAAGTTCCCCGCGGAGCTGGAGAACAGG ATTGACAGAC

AGCAGTTTGAAGAAACAGTTCGAACTCTAAATAATCTTTATGCAGAAGCAGAGAAACTTGGGGGCCAGTCGTATCTTGAAGGCTGTTTGGCTTGTTTAAC

AGCATACACCATCTTCTTATGCATGGAAACTCATTATGAGAAG - UNI27763 - GTCTTGAAGAAAGTCTCCAAATACATTCAAGAACAGAATGAGA

AGATATATGCTCCCCAAGGCCTCCTCCTAACAGACCCCATTGAGAGAGGACTTCGAGTT ATTGAAATCACCATCTATGAAGACAGAGGTGTGAGCAGTG

GAAGATAAACCACAGAGTTACAG GTCCTGCCTCCAGCTGGGACCTTCGTCTATCCACTGGCCGATGGCAGAGTGTCCCTACCTCCTCTCCAGAGCGTTA

TTCTCTTGTCTCTGCTGCCAGAGCCACGGTGCCACACCTGGAGTGACCGCTCGTCACTCAGCATCCACTTTGTCTCCCAGTTGTGTAGGACTCTGTGATC

TTTTGATTTGTTTCCAAGAAAATAAAGGAAGCAATTCTCTTTATAAATTCAAAGCCATTTAAAACACAGGCAGTTGGCCAGCCCAAGACAGAGTCGTTTT

CTTACCAGATACCAGTGTCACTGGTTCTCCTTGTCCCTTGGGTCAGTTTCCTAGGTGGCTTTATGATCCCACAAGTCATGTCTTAGCTCAGTCCCTCCCC

CAGATTAGTAGCAGGCTTTGAGGGTGTGTGTGCCTGTGGTCCGGCTGACCCGCCGCCCGAGTCCCCAAGCTACCAGCCTTGACGTGCTTCAGATCTTCAG

ATTGGTTTCTGCTGTTCAATTTCAGAGGCTCCTTGAGAGAATAATATATGTTACTTGTTTTAGTGTTGCAGTTATTATTAAGGCAGTATTTATGCAATTC

CGGTTGTTTCTTTGAAAGCAGTTCTGTTAATGTGCATTACCTCGAGATGTTGGGGAGATGTTGTGTGTGTTGCTTGTTCATTCCACAGATAAGTAAGCAC

AATGAGCAGACCCTCAGCCATCAGCTCCACCTGCCCCAGCTCTGCCCGGTGTGGAAGAAGCAAGTGTCCTAAGCACCTAACTCTAGTTTTGTTACAAGTA

TAACTTAGGAGAAAAAATTGGTAGAAATAATACAGTATGTTGCTAATTTGTAACCTACTTTAAACTCTGATTTATAGCCTCACATACAGTATTCAGGGCA

CAGAAATCTTTTGATTGACTCAAGTAAGTTTTGGCTTCCGTGTAACTTCAAGTTAAAGTTAATTTTTTTCAGCTCTTCTTTATCTCTATACTCTCTTAGT

ATCGGAATTTCTTATGTTCTTTTAGGAATTTGAGAGCACTGTGTTTGGGAGAAGTTAGGAAACATAAGGAATGAATGAAGCAGTTGAACTTGGAGATACT

GTAGGTGCTAATACTGGATCTAATCTTTCAGATTTAATTTGTTTTCTGGGCCTTGTAGTTACTCAGTAAACCCCTTAGATCTGTGTAATAATTTAATTGT

ATAACGCTCATTTGTTCCTTTAAAGCCTATTCTAGTCTGTCTGCCTTTTAAACTTGTTGCAATAATGTCGCCAAGATATAAACACATTAGTAAAACTTTT

CTT
Translation
 MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENR IDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEK - UNI2776

3 - VLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRV IEITIYEDRGVSSGR 

For any suggestions or comments, please send an email to unitrap@crg.es