Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015354 (Pcolce2)
Chromosomal location
Chr 9: 95538151 - 95595577 (+)
Description
procollagen C-endopeptidase enhancer 2 Gene [Source:MGI (curated);Acc:Pcolce2-001]
RefSeq_dna
NM_029620 
RefSeq_peptide
NP_083896.1 
UniGene
Mm.46016 
MGI
MGI:1923727 
Uniprot/SWISSPROT
Q8R4W6 
Human Ortholog
ENSG00000163710 (PCOLCE2)
Omim not available
UniTrap UNI23708
Vector Insertion
Chr 9: 95538293 - 95539070
Public Clones (ggtc)
Private Clones OST248313 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21933
Vector Insertion
Chr 9: 95539180 - 95570423
Public Clones (ggtc)
Private Clones OST313695 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23134
Vector Insertion
Chr 9: 95570680 - 95578763
Public Clones not available
Private Clones OST275378 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38412
Vector Insertion
Chr 9: 95587260 - 95593279
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015498
Sequence
CCGCGGCGCACTCTGTACCTGGCTGCGGGCGCCCGGCGGGATGCTGCAGTGAGCTGCCGGCCATGGGGGGCGCGAGCGCCTGCATCCCGCTCTGCCTGCT

TCTGGCCACCGCGCGGATGGCCCGGCCGCAGACGCCAGAGAG - UNI23708 - ACCTGTTTTCACATGTGGCGGCATTCTTACCGGAGAGTCTGGAT

TTATTGGCAGTGAAGGTTTTCCTGGAATGTACCCTCCGAATAGCAAATGTACTTGGAAAATCACA - UNI21933 - GTTCCTGAGGGCAAAGTGGTC

GTCTTGAATTTTCGATTCATAGACCTGGAGAATGACAACCTGTGTCGCTATGACTTCGTGGATGTGTACAATGGCCACGCCAATGGCCAGCGTATCGGGC

GCTTCTGTGGCACATTCCGACCTGGATCGCTCGTAGCCAGCGGCAACAAGATGACGGTACAAATGATTTCTGACGCCAACACCGCGGGAAGTGGCTTCAT

GGCAACGTACTCTGCCGCTGCGCCAGATGGAAAAG - UNI23134 - GAGACCGGTATTGTGGAGGACGCCTTGAAAAACCTTCCGGTACCTTTAAAA

CTCCCAACTGGCCAGACCGAGATTACCCCGTGGGAGTTACTTGTGTGTGGCACATCATAGCTCCGAAGAACCAG CTTATAGAGTTAAAGTTTGAGAAGT

TCGATGTTGAGCGCGATAACTACTGCAGATACGACTACGTGGCTGTGTTTAACGGTGGGGAAGTCAATGACGCCAAAAGAATTGGGAAGTACTGTGGGGA

CAGTCCACCTGT GCCGATCGTGTCTGAGAGAAATGAACTTCTTATTCAGTTCTTATCAGACTTAAGTTTAACAGCGGATGGTTTTATTGGTCACTACAA

ATTCAGGCCGAAAAAGTTTCCCACAACCACCACCACGCCCGTCACCACCACACTCCCCGTAACTACAG GTCTAAAGCCCACTGTGGCCCTGTGTCAGCA

GAAGTGTAGACGGATGGGGACTCTGGAGAGCAATTACTGTTCAAGCAACTTCG TGTTAGCCGGCACAGTTATCACGACCGTCACTCGAGGTGGGAGCTT

GCACGCCACAGTCTCGATCATCAGCATCTACAGGGAAGGCAACCTGGCCATTCAGCAGGCTGGCAAGAACATGAGTGTCAAGCTCACTGTGGTGTGCAGG

CAGTGCCCCCTTCTCAGACGAG GTCTCAATTACATTATTATGGGACAAGTGGGTGAAGATGGGCGTGGCAAAATCATGCCAAACAGCTTTGTCAAAATG

TTCAAGAATAAGAATCAGAAGCCCATGAACGCACTGAAGAACAAGCAGTGTTAGCCTGAGCTCTGTCACATAACCTGAACTTACTCATCACCGCTGAACG

ATCTGTCCACGTTAGG
Translation
MGGASACIPLCLLLATARMARPQTPER - UNI23708 - RPVFTCGGILTGESGFIGSEGFPGMYPPNSKCTWKIT - UNI21933 - VPEGKVVV

LNFRFIDLENDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGSLVASGNKMTVQMISDANTAGSGFMATYSAAAPDGKG - UNI23134 - GDRYCGGR

LEKPSGTFKTPNWPDRDYPVGVTCVWHIIAPKNQ LIELKFEKFDVERDNYCRYDYVAVFNGGEVNDAKRIGKYCGDSPPV VPIVSERNELLIQFLSDL

SLTADGFIGHYKFRPKKFPTTTTTPVTTTLPVTTG GLKPTVALCQQKCRRMGTLESNYCSSNFV VLAGTVITTVTRGGSLHATVSIISIYREGNLAIQ

QAGKNMSVKLTVVCRQCPLLRRG GLNYIIMGQVGEDGRGKIMPNSFVKMFKNKNQKPMNALKNKQC

For any suggestions or comments, please send an email to unitrap@crg.es