Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015357 (Clpx)
Chromosomal location
Chr 9: 65142102 - 65178465 (+)
Description
caseinolytic peptidase X (E.coli) Gene [Source:MGI (curated);Acc:Clpx-001]
RefSeq_dna
NM_001044389 NM_011802 
RefSeq_peptide
NP_001037854.1 NP_035932.2 
MGI
MGI:1346017 
Uniprot/SWISSPROT
Q9JHS4 
Uniprot/SPTREMBL
Q6P8N8 Q8BRZ3 Q8C4Z5 
Human Ortholog
ENSG00000166855 (CLPX)
Omim not available
UniTrap UNI10562
Vector Insertion
Chr 9: 65172107 - 65174588
Public Clones G031C08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113824
Sequence
TACTCCGGTGAGTAGAAGGCGGTGGGACGCTGGGATCGTCCAGGCCTGGCTGCCTGGTGGGGAAAACGCTGCGCCAGCATAGAACCGACGGAAGGGAGCG

GAGCCAGTCAGCGGAACACTCGCGCGACACGATCGGGTCGCTGAGCCCCCTCGATCCTCAGGGCGCGAAGCCCTGGCCTAGGCCCCGCGGAGATGTCCAG

TTGCGGCGCTTGTACCTGCGGCGCTGCGGCCGCCCGGCTTCTCACCACTTCGCTCACCTCCGCGCAGAGAG GTATTTCGTGTGGGCGAATCCATGTGCC

AGTGTTAGGAAGACTGGGGACGACCTTGGACGCTCAGGCTCTGCGCAGAGCTCCTCTTAGAACCTTTTCAGAAACACCAGCATACTTTGCCTCAAAAGAC

GGGGCAAACAAGGATGGCTCCGGAGATGGAAATAAG AAATCAGTGACTGAAGGAAGCAGTAAGAAATCAGGCTCTGGGAATTCTGGGAAAGGTGGAAAC

CAGCTTCGCTGTCCTAAATGTGGTGATTTGTGTACACACGTGGAGACCTTTGTGT CTTCCACGCGTTTTGTTAAGTGTGAAAAATGTCATCATTTTTTT

GTGGTGCTGTCGGAAGCAGACTCAAAGAAAAGCATAATTAAGGAACCCGAGTCCGCTGCAGAGGCTGTGAAGTTGGCATTCCAGCAGAAGCCACCTCCGC

CCCCCAAAAAG ATTTATAACTACCTCGACAAGTATGTTGTTGGCCAGTCGTTTGCTAAGAAAGTGCTTTCAGTTGCCGTGTATAATCATTATAAGAGAA

TATATAATAATATTCCAGCTAATCTGAGACAGCAAGCAGAGGCTGAGAAGCAGACATCACTAACACCTAGAG AGTTGCTTCAGATCGCTGGGATCAGCC

CACACGGCAATGCCTTGGGAGCCTCTATGCAGCAGCAGGTAAACCAGCAAATGCCTCAGGAGAAAAGAGGAGGTGAAGTGTTGGACTCTTCTCAAGATGA

TATAAAACTGGAAAAAAGTAATATTTTGCTGCTTGGACCAACTGGGTCAG GTAAAACCCTTCTGGCACAAACTTTAGCTAAATGCCTTGATGTTCCTTT

TGCTATCTGTGACTGTACAACTTTGACCCAGGCTGGATATGTAGGTGAAGATATTGAATCTGTGATTGCCAAACTACTCCAAGATGCCAATTACAATGTA

GAGAAAGCACAACAAG GAATTGTCTTTCTGGATGAAGTAGATAAGATTGGCAGTGTGCCAGGCATTCATCAATTACGGGATGTAGGTGGAGAAGGCGTT

CAGCAA GGTTTATTAAAACTTCTAGAAGGCACAATAGTCAATGTTCCAGAAAAGAATTCTCGAAAACTACGTGGAGAGACAGTTCAAGTTGATACAACA

AATGTCTTGTTTGTGGCATCTGGTGCCTTTAATGGCTTAGACAGAATCATCAGCAGGAGGAAAAATGAAAAG TATCTCGGCTTTGGAACACCATCTAAC

CTGGGAAAGGGCAGAAGGGCTGCAGCTGCAGCGGATCTTGCTAACCGAAGTGGGGAATCTAACACTCATCAGGACATTGAGGAGAAAGACCGGTTACTCC

GCCATGTGGAAGCCAGAGATCTTATTGAGTTTGGCATGATACCAGAGTTTGTGGGACGGTTGCCTGTGGTGGTTCCTTTGCACAGCCTAGATGAGAAGAC

ACTTGTACAAATACTGACCGAGCCACGGAATGCTGTTATTCCTCAGTATCAGGCCTTGTTCAGCATGGATAAG TGTGAGCTGAATGTTACTGAGGATGC

TCTGAAAGCCATAGCGAGATTGGCCCTGGAAAGAAAAACAGGTGCACGAGGCCTTCGGTCTATAATG - UNI10562 - GAAAAGCTGTTACTAGAAC

CAATGTTCGAAGTTCCTAATTCTGACATTGTATGTGTGGAAGTTGACAAAGAAGTAGTAGAAGGCAAAAAGGAACCAGGATACATTCG GGCACCCTCAA

AAGAGTCCTCTGAAGAGGAATATGACTCTGGAGTGGAGGAGGATGGATGGCCTCGTCAAGCGGATGCTGCAAACAGCTAAACCATCAGACTCTCACCTGT

ACATACAGCTTTCCCTGTTCTTTAGGGTCATAACAGTTTCCGCAGTCTGGCATTAAAGGCATTGAATCTATCTCGGATATCATACATGGTCAAAAGCCTT

TAAGATAAGAATCGGATCATGTATATTACTGTAACATCACATTGATTTATACAGAAGACAGTATATGGACTTTAATGACACAATGTTTAGAGATAAAAAT

GTACATTATTTTGGTTCTGTTTTTTAAAAATATACTTTAACAGAATTCTTAGGAATTCTCTTAAGCAATGCAGATGTTGCAATAACTTTACAATAATGTT

ACTCTAAAGATGAGAAAATAAAATCTTTAAAGTTGAGTACTGGGATCCCATTGTTTAGTGTTACCATTTTCTACCCACATTCCTTGGAAATATTTGAATT

TTCATTTTAAAAATTGGATCAGGTAGTTTTTAGATAAGTAAGAATACCTTGAAAACCCACATTTTGACGACATGTTTATATTTCTGGTCTCTTCAGCTAG

TGGAGAGGCATTGGTTTCCCAGCTGGCACCATTAGTAACAGAGGCATTCCCTTGATGACTTGTCTGACTTACTTGCATCTCTGAACCATTTTTTATCACC

ATCAGTGAGCAAATGGGATTAATAATCTGATTTAAATATTTAGAAGGCCATAGGCAACTAATCTTACAGAGCTTGCTGTCAGCCATGTGCTAGACTAAAT

AAAATATCTTATAGTGTGCACTTTTTCTAAAGTC
Translation
MSSCGACTCGAAAARLLTTSLTSAQRG GISCGRIHVPVLGRLGTTLDAQALRRAPLRTFSETPAYFASKDGANKDGSGDGNK KSVTEGSSKKSGSGNS

GKGGNQLRCPKCGDLCTHVETFVS SSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAEAVKLAFQQKPPPPPKK IYNYLDKYVVGQSFAKKVLSVA

VYNHYKRIYNNIPANLRQQAEAEKQTSLTPRE ELLQIAGISPHGNALGASMQQQVNQQMPQEKRGGEVLDSSQDDIKLEKSNILLLGPTGSG GKTLLA

QTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQG GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQ GLLKLLEGTIVNVPEKNS

RKLRGETVQVDTTNVLFVASGAFNGLDRIISRRKNEK YLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEFGMIPEFVGR

LPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDK CELNVTEDALKAIARLALERKTGARGLRSIM - UNI10562 - EKLLLEPMFEVPNSDI

VCVEVDKEVVEGKKEPGYIR RAPSKESSEEEYDSGVEEDGWPRQADAANS
Transcript ENSMUST00000015501
Sequence
TACTCCGGTGAGTAGAAGGCGGTGGGACGCTGGGATCGTCCAGGCCTGGCTGCCTGGTGGGGAAAACGCTGCGCCAGCATAGAACCGACGGAAGGGAGCG

GAGCCAGTCAGCGGAACACTCGCGCGACACGATCGGGTCGCTGAGCCCCCTCGATCCTCAGGGCGCGAAGCCCTGGCCTAGGCCCCGCGGAGATGTCCAG

TTGCGGCGCTTGTACCTGCGGCGCTGCGGCCGCCCGGCTTCTCACCACTTCGCTCACCTCCGCGCAGAGAG GTATTTCGTGTGGGCGAATCCATGTGCC

AGTGTTAGGAAGACTGGGGACGACCTTGGACGCTCAGGCTCTGCGCAGAGCTCCTCTTAGAACCTTTTCAGAAACACCAGCATACTTTGCCTCAAAAGAC

GGGGCAAACAAGGATGGCTCCGGAGATGGAAATAAG AAATCAGTGACTGAAGGAAGCAGTAAGAAATCAGGCTCTGGGAATTCTGGGAAAGGTGGAAAC

CAGCTTCGCTGTCCTAAATGTGGTGATTTGTGTACACACGTGGAGACCTTTGTGT CTTCCACGCGTTTTGTTAAGTGTGAAAAATGTCATCATTTTTTT

GTGGTGCTGTCGGAAGCAGACTCAAAGAAAAGCATAATTAAGGAACCCGAGTCCGCTGCAGAGGCTGTGAAGTTGGCATTCCAGCAGAAGCCACCTCCGC

CCCCCAAAAAG ATTTATAACTACCTCGACAAGTATGTTGTTGGCCAGTCGTTTGCTAAGAAAGTGCTTTCAGTTGCCGTGTATAATCATTATAAGAGAA

TATATAATAATATTCCAGCTAATCTGAGACAGCAAGCAGAGGCTGAGAAGCAGACATCACTAACACCTAGAG AGTTAGAAATAAGAAGACGGGAGGATG

AGTACAGATTTACAA AGTTGCTTCAGATCGCTGGGATCAGCCCACACGGCAATGCCTTGGGAGCCTCTATGCAGCAGCAGGTAAACCAGCAAATGCCTC

AGGAGAAAAGAGGAGGTGAAGTGTTGGACTCTTCTCAAGATGATATAAAACTGGAAAAAAGTAATATTTTGCTGCTTGGACCAACTGGGTCAG GTAAAA

CCCTTCTGGCACAAACTTTAGCTAAATGCCTTGATGTTCCTTTTGCTATCTGTGACTGTACAACTTTGACCCAGGCTGGATATGTAGGTGAAGATATTGA

ATCTGTGATTGCCAAACTACTCCAAGATGCCAATTACAATGTAGAGAAAGCACAACAAG GAATTGTCTTTCTGGATGAAGTAGATAAGATTGGCAGTGT

GCCAGGCATTCATCAATTACGGGATGTAGGTGGAGAAGGCGTTCAGCAA GGTTTATTAAAACTTCTAGAAGGCACAATAGTCAATGTTCCAGAAAAGAA

TTCTCGAAAACTACGTGGAGAGACAGTTCAAGTTGATACAACAAATGTCTTGTTTGTGGCATCTGGTGCCTTTAATGGCTTAGACAGAATCATCAGCAGG

AGGAAAAATGAAAAG TATCTCGGCTTTGGAACACCATCTAACCTGGGAAAGGGCAGAAGGGCTGCAGCTGCAGCGGATCTTGCTAACCGAAGTGGGGAA

TCTAACACTCATCAGGACATTGAGGAGAAAGACCGGTTACTCCGCCATGTGGAAGCCAGAGATCTTATTGAGTTTGGCATGATACCAGAGTTTGTGGGAC

GGTTGCCTGTGGTGGTTCCTTTGCACAGCCTAGATGAGAAGACACTTGTACAAATACTGACCGAGCCACGGAATGCTGTTATTCCTCAGTATCAGGCCTT

GTTCAGCATGGATAAG TGTGAGCTGAATGTTACTGAGGATGCTCTGAAAGCCATAGCGAGATTGGCCCTGGAAAGAAAAACAGGTGCACGAGGCCTTCG

GTCTATAATG - UNI10562 - GAAAAGCTGTTACTAGAACCAATGTTCGAAGTTCCTAATTCTGACATTGTATGTGTGGAAGTTGACAAAGAAGTAG

TAGAAGGCAAAAAGGAACCAGGATACATTCG GGCACCCTCAAAAGAGTCCTCTGAAGAGGAATATGACTCTGGAGTGGAGGAGGATGGATGGCCTCGTC

AAGCGGATGCTGCAAACAGCTAAACCATCAGACTCTCACCTGTACATACAGCTTTCCCTGTTCTTTAGGGTCATAACAGTTTCCGCAGTCTGGCATTAAA

GGCATTGAATCTATCTCGGATATCATACATGGTCAAAAGCCTTTAAGATAAGAATCGGATCATGTATATTACTGTAACATCACATTGATTTATACAGAAG

ACAGTATATGGACTTTAATGACACAATGTTTAGAGATAAAAATGTACATTATTTTGGTTCTGTTTTTTAAAAATATACTTTAACAGAATTCTTAGGAATT

CTCTTAAGCAATGCAGATGTTGCAATAACTTTACAATAATGTTACTCTAAAGATGAGAAAATAAAATCTTTAAAGTTGAGTACTGGGATCCCATTGTTTA

GTGTTACCATTTTCTACCCACATTCCTTGGAAATATTTGAATTTTCATTTTAAAAATTGGATCAGGTAGTTTTTAGATAAGTAAGAATACCTTGAAAACC

CACATTTTGACGACATGTTTATATTTCTGGTCTCTTCAGCTAGTGGAGAGGCATTGGTTTCCCAGCTGGCACCATTAGTAACAGAGGCATTCCCTTGATG

ACTTGTCTGACTTACTTGCATCTCTGAACCATTTTTTATCACCATCAGTGAGCAAATGGGATTAATAATCTGATTTAAATATTTAGAAGGCCATAGGCAA

CTAATCTTACAGAGCTTGCTGTCAGCCATGTGCTAGACTAAATAAAATATCTTATAGTGTGCACTTTTTCTAAAGTC
Translation
MSSCGACTCGAAAARLLTTSLTSAQRG GISCGRIHVPVLGRLGTTLDAQALRRAPLRTFSETPAYFASKDGANKDGSGDGNK KSVTEGSSKKSGSGNS

GKGGNQLRCPKCGDLCTHVETFVS SSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAEAVKLAFQQKPPPPPKK IYNYLDKYVVGQSFAKKVLSVA

VYNHYKRIYNNIPANLRQQAEAEKQTSLTPRE ELEIRRREDEYRFTK KLLQIAGISPHGNALGASMQQQVNQQMPQEKRGGEVLDSSQDDIKLEKSNI

LLLGPTGSG GKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQG GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQ GL

LKLLEGTIVNVPEKNSRKLRGETVQVDTTNVLFVASGAFNGLDRIISRRKNEK YLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVE

ARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDK CELNVTEDALKAIARLALERKTGARGLRSIM - UNI10562 - 

EKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR RAPSKESSEEEYDSGVEEDGWPRQADAANS

For any suggestions or comments, please send an email to unitrap@crg.es