Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015401 (Tmem27)
Chromosomal location
Chr X: 160526762 - 160556792 (+)
Description
transmembrane protein 27 Gene [Source:MGI (curated);Acc:Tmem27-001]
RefSeq_dna
NM_020626 
RefSeq_peptide
NP_065651.1 
UniGene
Mm.420896 Mm.143766 
MGI
MGI:1926234 
Uniprot/SWISSPROT
Q9ESG4 
Uniprot/SPTREMBL
A2AHZ4 A2AHZ5 
Human Ortholog
ENSG00000147003 (TMEM27)
Omim not available
UniTrap UNI16256
Vector Insertion
Chr X: 160528118 - 160528263
Public Clones not available
Private Clones OST464441 (lexicon) OST117705 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22459
Vector Insertion
Chr X: 160528118 - 160528263
Public Clones not available
Private Clones OST296516 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30372
Vector Insertion
Chr X: 160546452 - 160556127
Public Clones CMHD-GT_417G9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015545
Sequence
CCGGGTCACAGAATGGTTAAAGCAGCTTTAAGTAGAGAGTGGATTATTTTCCCCTCAGTTTGTCTTCTGTTTGCGGCTCTGAAAGAATGTTGTGGGCGCT

CTTTTTCCTGGTGACTACTATTCACGCTGAACTCTGCCATCCAG - UNI16256 - - UNI22459 - ATGCAGAAAATGCCTTTAAAGTAAGACTT

AGCATCAGAGCAGCTCTTGGAGATAAAGCA TATGTCTGGGACACGGATCAAGAATACCTCTTCAGAGCAATGGTGGCATTCTCCATGAGAAAAGTTCCC

AACAGAGAAGCAACAGA AATTTCCCATGTCCTGCTTTGCAACATAACCCAGAGGGTGTCGTTCTGGTTTGTGGTCACGGACCCTTCCAACAATTATACT

CTTCCTGCAGCTGAAGTACAGTCGGCCATAAG AAAGAATAGGAACCGGATCAACAGTGCATTTTTTCTGGATGACCATACTCTGGAATTTTTAAAAATT

CCTTCTACTCTTGCTCCCCCGATGGAGCCATCTGTGCCCGTCTGGATTATTGTATTCGGTGTGATATTTTGCATTGTTACAGTTGCAATTGCACTACTGG

TTCTATCTGGAATCCGGCAACGCAGAAG - UNI30372 - GAACAACAAAGGACCACCTGGAGTGGAAGATGCAGAAGACAAGTGTGAAAACATCATC

ACAATAGAAAATGGCATCCCTTGTGATCCCTTGGACATGAAGGGAGGGCACATTAATGATGGCTTCTTGACAGAGGATGAGCGCCTCACCCCTCTCTGAG

AGTGACAGTCTTGTAAGAAAATTTTAAGATGCTTGAATGTGATTGACAACAAATTATATCCACAAAGACCAATGAAATCATAAGGTGTTAGCTTCTCAAA

ATATTCTAGAATTTTCTTTTTGATAACTGATTATGTAGGTATAGTGTGTGTTTGTAGTTACTGATTTGAGCATTTCTAGAAATAAAGTCAGGGCTGTAAC

TATATTTCATATTTTGAAGACCTAAGAAAAAAATTTTCACTGGAGAATGGCTATAACATGGCATAGAAATCATTAAAAATGGATCTTTTTGAATACTGTT

TATATTACTCTGTATATGATGCATCGAGTAAAATTAAACAAGAGATGGATAAAAATGGCAAGGGAATTTTATTCTGTTATCACACCAACAGTTGCTTGTA

TAGTTTCTGCATATTAGTCTTTAGTAGGGCAAGCAGATCTATTTGTTGTTGCCTGCAATTTGTACACATCCTACCTATGCTGATTTAATAAAGTAGTGAT

CATCTC
Translation
MLWALFFLVTTIHAELCHPD - UNI16256 - - UNI22459 - DAENAFKVRLSIRAALGDKA YVWDTDQEYLFRAMVAFSMRKVPNREATE EI

SHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIR RKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVPVWIIVFGVIFCIVTVAIALLVLSGIR

QRRR - UNI30372 - RNNKGPPGVEDAEDKCENIITIENGIPCDPLDMKGGHINDGFLTEDERLTPL
Transcript ENSMUST00000112280
Sequence
GACATTGCTAGAGTGGCTGGCCTGGCTTGGCTGCCTCTTCCTCTGGGACAGCTTTTCTTCTCTCAACATCCCTGGTGCCAAGGTGGAGAAATG ATGGTG

GCTCGCTGATTTCTCCGATACCCTAATCCGGGTCACAGAATGGTTAAAGCAGCTTTAAGTAGAGAGTGGATTATTTTCCCCTCAGTTTGTCTTCTGTTTG

CGGCTCTGAAAGAATGTTGTGGGCGCTCTTTTTCCTGGTGACTACTATTCACGCTGAACTCTGCCATCCAG - UNI16256 - - UNI22459 - AT

GCAGAAAATGCCTTTAAAGTAAGACTTAGCATCAGAGCAGCTCTTGGAGATAAAGCA TATGTCTGGGACACGGATCAAGAATACCTCTTCAGAGCAATG

GTGGCATTCTCCATGAGAAAAGTTCCCAACAGAGAAGCAACAGA AATTTCCCATGTCCTGCTTTGCAACATAACCCAGAGGGTGTCGTTCTGGTTTGTG

GTCACGGACCCTTCCAACAATTATACTCTTCCTGCAGCTGAAGTACAGTCGGCCATAAG AAAGAATAGGAACCGGATCAACAGTGCATTTTTTCTGGAT

GACCATACTCTGGAATTTTTAAAAATTCCTTCTACTCTTGCTCCCCCGATGGAGCCATCTGTGCCCGTCTGGATTATTGTATTCGGTGTGATATTTTGCA

TTGTTACAGTTGCAATTGCACTACTGGTTCTATCTGGAATCCGGCAACGCAGAAG - UNI30372 - GAACAACAAAGGACCACCTGGAGTGGAAGAT

GCAGAAGACAAGTGTGAAAACATCATCACAATAGAAAATGGCATCCCTTGTGATCCCTTGGACATGAAGGGAGGGCACATTAATGATGGCTTCTTGACAG

AGGATGAGCGCCTCACCCCTCTCTGAGAGTGACAGTCTTGTAAGAAAATTTTAAGATGCTTGAATGTGATTGACAACAAATTATATCCACAAAGACCAAT

GAAATCATAAGGTGTTAGCTTCTCAAAATATTCTAGAATTTTCTTTTTGATAACTGATTATGTAGGTATAGTGTGTGTTTGTAGTTACTGATTTGAGCAT

TTCTAGAAATAAAGTCAGGGCTGTAACTATATTTCATATTTTGAAGACCTAAGAAAAAAATTTTCACTGGAGAATGGCTATAACATGGCATAGAAATCAT

TAAAAATGGATCTTTTTGAATACTGTTTATATTACTCTGTATATGATGCATCGAGTAAAATTAAACAAGAGATGGATAAAAATGGCAAGGGAATTTTATT

CTGTTATCACACCAACAGTTGCTTGTATAGTTTCTGCATATTAGTCTTTAGTAGGGCAAGCAGATCTATTTGTTGTTGCCTGCAATTTGTACACATCCTA

CCTATGCTGATTTAATAAAGTAGTGATCATCTCA
Translation
 MLWALFFLVTTIHAELCHPD - UNI16256 - - UNI22459 - DAENAFKVRLSIRAALGDKA YVWDTDQEYLFRAMVAFSMRKVPNREATE E

ISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIR RKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVPVWIIVFGVIFCIVTVAIALLVLSGI

RQRRR - UNI30372 - RNNKGPPGVEDAEDKCENIITIENGIPCDPLDMKGGHINDGFLTEDERLTPL
Transcript ENSMUST00000112278
Sequence
CCGGGTCACAGAATGGTTAAAGCAGCTTTAAGTAGAGAGTGGATTATTTTCCCCTCAGTTTGTCTTCTGTTTGCGGCTCTGAAAGAATGTTGTGGGCGCT

CTTTTTCCTGGTGACTACTATTCACGCTGAACTCTGCCATCCAG - UNI16256 - - UNI22459 - ATGCAGAAAATGCCTTTAAAGTAAGACTT

AGCATCAGAGCAGCTCTTGGAGATAAAGCA TATGTCTGGGACACGGATCAAGAATACCTCTTCAGAGCAATGGTGGCATTCTCCATGAGAAAAGTTCCC

AACAGAGAAGCAACAGA AATTTCCCATGTCCTGCTTTGCAACATAACCCAGAGGGTGTCGTTCTGGTTTGTGGTCACGGACCCTTCCAACAATTATACT

CTTCCTGCAGCTGAAGTACAGTCGGCCATAAG - UNI30372 - GAACAACAAAGGACCACCTGGAGTGGAAGATGCAGAAGACAAGTGTGAAAACAT

CATCACAATAGAAAATGGCATCCCTTGTGATCCCTTGGACATGAAGGGAGGGCACATTAATGATGGCTTCTTGACAGAGGATGAGCGCCTCACCCCTCTC

TGAGAGTGACAGTCTTGTAAGAAAATTTTAAGATGCTTGAATGTGATTGACAACAAATTATATCCACAAAGACCAATGAAATCATAAGGTGTTAGCTTCT

CAAAATATTCTAGAATTTTCTTTTTGATAACTGATTATGTAGGTATAGTGTGTGTTTGTAGTTACTGATTTGAGCATTTCTAGAAATAAAGTCAGGGCTG

TAACTATATTTCATATTTTGAAGACCTAAGAAAAAAATTTTCACTGGAGAATGGCTATAACATGGCATAGAAATCATTAAAAATGGATCTTTTTGAATAC

TGTTTATATTACTCTGTATATGATGCATCGAGTAAAATTAAACAAGAGATGGATAAAAATGGCAAGGGAATTTTATTCTGTTATCACACCAACAGTTGCT

TGTATAGTTTCTGCATATTAGTCTTTAGTAGGGCAAGCAGATCTATTTGTTGTTGCCTGCAATTTGTACACATCCTACCTATGCTGATTTAATAAAGTAG

TGATCATCTC
Translation
 - UNI16256 - - UNI22459 -  MVAFSMRKVPNREATE EISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIR - UNI30372 - RN

NKGPPGVEDAEDKCENIITIENGIPCDPLDMKGGHINDGFLTEDERLTPL

For any suggestions or comments, please send an email to unitrap@crg.es