Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015468 (Notch4)
Chromosomal location
Chr 17: 34701240 - 34725476 (+)
Description
Notch gene homolog 4 (Drosophila) Gene [Source:MGI (curated);Acc:Notch4-001]
RefSeq_dna
NM_010929 
RefSeq_peptide
NP_035059.2 
UniGene
Mm.173813 
MGI
MGI:107471 
Uniprot/SWISSPROT
P31695 
Uniprot/SPTREMBL
A2CG28 B2RQR1 
Human Ortholog
ENSG00000204301 (NOTCH4)
Omim not available
UniTrap UNI37890
Vector Insertion
Chr 17: 34701455 - 34702245
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30695
Vector Insertion
Chr 17: 34705818 - 34706979
Public Clones IST14745E3 (tigm) IST10190F1 (tigm) IST10262A6 (tigm) IST11476H3HMF2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10535
Vector Insertion
Chr 17: 34709746 - 34710693
Public Clones G055G12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11180
Vector Insertion
Chr 17: 34713472 - 34713713
Public Clones G042D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34156
Vector Insertion
Chr 17: 34723620 - 34724061
Public Clones IST13549A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015612
Sequence
TCAGGAAACAGCTCAGACTGAGGCGTGCAGCAGGCTCAGGAGGAAGAAGGGCGGTAGAGGCAGAGGAGGTGGCCTTGCCTGGCCACAAGGGCTCTGAGGG

TCCCTGCCTGAAGAGGGAGAGGAGATCCGGGCCAGGGGCAGGCGCTCTGGAATGCAGCCCCAGTTGCTGCTGCTGCTGCTCTTGCCACTCAATTTCCCTG

TCATCCTGACCAGAG AGCTTCTGTGTGGAGGATCCCCAGAGCCCTGTGCCAACGGAGGCACCTGCCTGAGGCTATCTCGGGGACAAGGGATCTGCCA G

TGTGCCCCTGGATTTCTGGGTGAGACTTGCCAGTTTCCTGACCCCTGCAGGGATACCCAACTCTGCAAGAATGGTGGCAGCTGCCAAGCCCTGCTCCCCA

CACCCCCAAGCTCCCGTAGTCCTACTTCTCCACTGACCCCTCACTTCTCCTGCACCTGCCCCTCTGGCTTCACCGGTGATCGATGCCAAACCCATCTGGA

AGAGCTCTGTCCACCTTCTTTCTGTTCCAACGGGGGTCACTGCTATGTTCAGGCCTCAGGCCGCCCACAGTGCTCCTGCGAGCCTGGGTGGACAG GTGA

GCAATGCCAGCTCCGAGACTTCTGCTCAGCCAACCCCTGTGCCAACGGAGGCGTGTGCCTGGCCACATACCCCCAGATCCAGTGCCGCTGTCCACCTGGG

TTCGAGGGTCACACCTGTGAACGCGACATCAACGAGTGCTTCCTGGAGCCGGGACCCTGCCCTCAGGGCACCTCCTGCCATAACACCTTGGGTTCCTACC

AGTGTCTCTGCCCTGTGGGGCAGGAAGGTCCCCAGTGCAAGCTCAGGAAGGGAGCCTGCCCTCCTGGAAGCTGTCTCAATGGGGGCACCTGCCAGCTGGT

CCCAGAGGGACACTCCACCTTTCATCTCTGCCTCTGTCCCCCAG GTTTCACGGGGCTGGACTGTGAGATGAACCCAGATGACTGTGTCAGGCACCAGTG

TCAGAACGGGGCCACCTGTCTGGATGGGCTGGACACCTACACCTGCCTCTGCCCCAAGACATGGAAGG GCTGGGACTGCTCTGAAGATATAGATGAATG

TGAAGCCCGGGGTCCCCCTCGCTGCAGGAACGGTGGCACCTGCCAGAACACAGCTGGCAGCTTTCACTGTGTGTGCGTGAGTGGCTGGGGAGGCGCAGGC

TGTGAGGAGAACCTGGATGACTGTGCAGCTGCCACCTGTGCCCCGGGATCCACCTGCATCGACCGTGTGGGCTCCTTCTCCTGCCTCTGCCCACCTGGAC

GCACAG GCCTCCTGTGCCACCTGGAAGACATGTGTTTGAGTCAGCCGTGCCACGTGAATGCCCAGTGCAGCACCAACCCTCTGACAGGCTCCACCCTCT

GCATATGCCAGCCTGGCTACTCAGGATCCACCTGTCACCAAGATCTGGATGAGTGCCAAATGG - UNI30695 - CCCAGCAAGGACCCAGTCCCTGC

GAACATGGCGGCTCCTGCATCAACACCCCTGGCTCCTTCAACTGCCTCTGCCTGCCTGGTTACACGGGCTCCCGCTGTGAAGCTGACCACAATGAGTGCC

TGTCACAGCCCTGCCACCCAGGCAGCACCTGCCTGGACCTGCTTGCAACCTTCCACTGCCTCTGCCCACCAG GCTTGGAAGGGAGGCTCTGTGAGGTGG

AGGTCAATGAGTGCACCTCTAATCCCTGCCTGAACCAAGCTGCCTGCCATGACCTGCTCAACGGCTTCCAGTGCCTCTGCCTTCCTG GATTCACCGGCG

CCCGATGTGAGAAAGACATGGACGAGTGTAGCAGCACCCCCTGTGCCAATGGGGGGCGCTGCCGAGACCAGCCTGGAGCCTTCTACTGCGAGTGTCTCCC

AG GCTTTGAAGGGCCACACTGTGAGAAAGAAGTGGACGAATGTCTGAGTGACCCCTGCCCCGTGGGAGCCAGCTGCCTTGATCTCCCCGGAGCATTCTT

CTGCCTCTGCCGTCCTGGTTTCACAG - UNI10535 - GTCAACTTTGTGAGGTTCCCTTGTGCACCCCCAACATGTGCCAACCTGGACAGCAATGCC

AAGGTCAGGAACACAGAGCCCCCTGCCTCTGCCCTGACGGAAGTCCTGGCTGTGTTCCTGCCGAGGACAACTGCCCCTGTCACCATGGCCATTGCCAGAG

 ATCCTTGTGTGTGTGTGATGAGGGCTGGACTGGACCAGAATGCGAGACAGAACTGGGTGGCTGCATCTCCACACCCTGTGCCCATGGGGGGACCTGCCA

CCCACAGCCATCTGGCTACAACTGTACCTGCCCTGCAGGCTACATGG GGTTGACCTGTAGTGAGGAGGTGACAGCTTGTCACTCAGGGCCCTGTCTCAA

TGGTGGCTCCTGCAGCATCCGTCCTGAGGGCTATTCCTGCACCTGCCTTCCAAGTCACACAGGTCGCCACTGCCAGACTGCCGTGGACCACTGTGTGTCT

G CCTCGTGCCTCAATGGGGGTACCTGTGTGAACAAGCCTGGCACTTTCTTCTGCCTCTGTGCCACTGGCTTCCAGGGGCTGCACTGTGAGGAGAAGACT

AACCCCAGCTGTGCAGACAG - UNI11180 - CCCCTGCAGGAACAAGGCAACCTGCCAAGACACACCTCGAGGGGCCCGCTGCCTCTGCAGCCCTGG

CTATACAGGAAGCAGCTGCCAG ACTCTGATAGACTTGTGTGCCCGGAAGCCCTGTCCACACACTGCTCGATGCCTCCAGAGTGGGCCCTCGTTCCAGTG

CCTGTGCCTCCAGGGATGGACAGGGGCTCTCTGTGACTTCCCACTGTCCTGCCAGAAGGCCGCGATGAGCCAAG GCATAGAGATCTCTGGCCTGTGCCA

GAATGGAGGCCTCTGTATTGACACGGGCTCCTCCTATTTCTGCCGCTGCCCTCCTGGATTCCAAGGCAAGTTATGCCAGGATAATGTGAACCCCTGTGAG

CCCAATCCCTGCCATCACGGGTCTACCTGTGTGCCTCAGCCCAGTGGCTATGTCTGCCAG TGTGCCCCAGGCTATGAGGGACAGAACTGCTCAAAAGTA

CTTGACGCTTGTCAGTCCCAGCCCTGCCACAACCACGGAACCTGTACCTCCAGGCCTGGAGGCTTCCACTGTGCCTGCCCTCCAGGCTTCGTGGGACTGC

GCTGTGAGGGAGATGTGGATGAGTGTCTGGACCGGCCCTGTCACCCCTCGGGCACTGCAGCTTGCCACTCTTTAGCCAACGCCTTCTACTGCCAGTGTCT

GCCTGGGCACACAG GCCAGCGGTGTGAGGTGGAGATGGACCTCTGTCAGAGCCAACCCTGCTCCAATGGAGGATCCTGTGAGATCACAACAGGGCCACC

CCCTGGCTTCACCTGTCACTGCCCCAAG GGTTTTGAAGGCCCCACCTGCAGCCACAAAGCCCTTTCCTGCGGCATCCATCACTGCCACAATGGAGGCCT

ATGTCTGCCCTCCCCTAAGCCAGGGTCACCACCACTCTGTGCCTGCCTCAGTGGTTTTGGGGGCCCTGACTGTCTGACACCTCCAGCTCCACCGGGCTGC

GGTCCCCCCTCACCCTGCCTGCACAATGGTACCTGCACTGAGACCCCTGGGTTGGGCAACCCGGGCTTTCAATGCACCTGCCCTCCTGACTCTCCAGGGC

CCCGGTGTCAAAGGCCAGGGGCAAGTGGGTGTGAGGGCCGAGGTGGTGATGGGACCTGCGATGCTGGCTGCAGTGGCCCAGGAGGAGACTGGGATGGAGG

GGACTGTTCCCTGGGGGTCCCAGACCCCTGGAAGGGCTGTCCCCCGCATTCCCAGTGCTGGCTTCTGTTCCGGGACGGACGGTGTCACCCGCAGTGTGAC

TCTGAGGAGTGTCTCTTTGATGGCTACGACTGTGAAATCCCTCTAACCTGCAT CCCAGCCTATGACCAGTACTGCCGAGATCACTTCCACAACGGGCAC

TGTGAGAAAGGCTGCAATAACGCTGAATGTGGCTGGGACGGGGGAGACTGCAGACCAGAAGGGGAAGACTCAGAGGGGAGGCCCTCCCTGGCCCTGCTGG

TGGTGCTGAGGCCCCCAGCCCTGGATCAGCAGCTGCTTGCCCTGGCACGAGTGCTGTCCCTGACTCTGAGGGTCGGTCTCTGGGTGAGGAAGGACAGTGA

AGGCAGGAACATGGTGTTCCCCTATCCTGGGACCCGGGCCAAAGAGGAGCTGAGTGGAGCTAGGGATTCCTCTTCATGGGAAAGACAAGCCCCTCCCACT

CAGCCCCTGGGCAAGGAGACAGAGTCTCTTGGTGCAGG GTTTGTGGTAGTGATGGGAGTGGATCTGTCCCGCTGTGGTCCGGAACATCCTGCGTCCCGC

TGCCCCTGGGACTCTGGACTCCTGCTGCGCTTCCTTGCAGCAATGGCAGCAGTGGGAGCTCTGGAGCCCCTGCTGCCTGGACCCTTGCTGGCGGCTCACC

CTCAAGCAGGGACCA GGCCCTCTGCCAACCAGCTTCCCTGGCCCATTCTATGTTCACCAGTGGTTGGGGTGCTTCTCCTGGCCCTTGGGGCCCTTCTCG

TCCTCCAGCTCATTCGGCGACGGCGACGAGAACATGGGGCCCTGTGGCTGCCCCCTGGTTTCATTCGAAGGCCTCAGACACAGCAGGCACCCCACCGGCG

GAGGCCCCCACTGGGCGAGGACAACATTGGTCTTAA GGCACTGAAGCCAGAGGCCGAAGTGGATGAGGATGGAGTGGCCATGTGCTCGGGCCCTGAAGA

GGGAGAG GCTGAAGAAACAGCCTCAGCCTCCAGGTGCCAGCTTTGGCCGCTCAACAGCGGCTGTGGAGAGCTCCCCCAGGCAGCCATGCTGACCCCTCC

TCAGGAGTGTGAATCGGAGGTTCTGGATGTGGACACCTGTGGACCTG ATGGGGTGACACCCCTGATGTCAGCCGTCTTCTGTGGGGGAGTGCAGTCCAC

GACTGGGGCTAGTCCACAGAGACTGGGGCTAGGAAATCTGGAACCCTGGGAACCACTGCTGGATAGAGGGGCCTGCCCCCAGGCTCACACTGTGGGCACT

GGAGAGACGCCTCTGCACCTAGCTGCCAGATTCTCTCGGCCAACCGCTGCCCGCCGCCTCCTTGAGGCTGGAGCCAACCCCAACCAGCCAGACCGCGCTG

GGCGCACCCCACTTCACACTGCTGTGGCTGCCGACGCTCGGGAGGTTTGCCAG CTCCTATTGGCCAGCAGACAGACTACGGTGGACGCCCGCACAGAGG

ACGGGACTACACCTTTGATGCTGGCTGCCAGGCTGGCCGTGGAGGACCTGGTTGAAGAATTGATCGCAGCCCGAGCAGATGTAGGAGCCAGGGATAAAAG

GG - UNI34156 - GAAAAACTGCACTGCACTGGGCCGCTGCTGTGAACAACGCCCGAGCCGCCCGCTCTCTCCTCCAGGCTGGAGCGGATAAAGATG

CCCAGGACAGTAGG GAACAGACGCCGCTTTTCCTGGCAGCGCGCGAAGGAGCCGTGGAGGTGGCGCAGCTGTTGCTGGAGCTCGGGGCGGCCCGGGGAC

TGCGAGACCAGGCCGGGCTGGCCCCAGGAGATGTGGCCCGCCAGCGCAGTCACTGGGACCTGCTAACGCTGCTGGAAGGGGCTGGACCGACTACGCAGGA

GGCCCGTGCGCACGCACGCACCACGCCGGGGGGCGGGGCCGCGCCGCGCTGCCGGACGCTGTCTGCGGGAGCGCGCCCGCGCGGGGGCGGAGCCTGTCTG

CAGGCTCGCACTTGGTCGGTGGACTTGGGAGCGCGCGGAGGGAAGGTGTATGCTCGCTGCCGGAGCCGATCTGGAAGCTGCGGAGGCCCCACCACGCGCG

GCCGCAGGTTCTCCGCGGGCTCCCGTGGACGACGCGGGGCTAGGGCATCACAGGATGACTGGCCTCGCGACTGGGTGGCCCTGGAAGCCTGCGGCTCCGC

CTGCAGTGCGCCGATCCCGCCTCCCAGCCTGACCCCGTCCCCAGAACGTGGATCCCCTCAAGTTGCCTGGGGTCTTCCAGTTCACCAAGAGATTCCCTTA

AACTCGGTTGTAAGAAATCTGAACTAGGCAGCTGCGTGGAAGGAAGGAAGCGACACGTACGAGTCTGGAAGACTCCGGACTTTTAAGGCCAAAATAACCG

TTAAGCTCACTTGTCTCCCCCATAGAGTATGCACAGCAATGGGAAGAGGGTTTAGGATGTCCGGTTGAGATAGACCGTGATTTTCCTGGAAAATAGGGCA

GCTTCAAGAGGACAAAGTTGATTTCGAGAATCCCTAAACTCTGGAACCAAGAACTGTGGGCGAATTGGGTGTAAAATGTTTCTTGTGTATGGTTTCCCAA

AAGGAGCCTCTGCTATCTACTGCCCACAAGTAGCTGGCAACTATTTATTAAGCACCTACGATGTGCCGGGTGTTGTGTAGATGAACAGTAAGTAACCAGT

GGCCCATCCAGCTGATGACTCCTTGCCCTCTCTCTGCCTCCCCACAAGGACACTGGTGCAGGGATGAGGCCATGTTCTCCAGTCACTGCTATCTCCGAGA

ACCCCAAACTCATGGATAATAAAGCTAATTTGAAGTGCTACTTTATCTTCTGAGGGACTAAAGGGTGAGATGG
Translation
MQPQLLLLLLLPLNFPVILTRE ELLCGGSPEPCANGGTCLRLSRGQGICQ QCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTP

HFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTG GEQCQLRDFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINE

CFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPG GFTGLDCEMNPDDCVRHQCQNGATCLDGL

DTYTCLCPKTWKG GWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTG GLLCH

LEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMA - UNI30695 - AQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADH

NECLSQPCHPGSTCLDLLATFHCLCPPG GLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPG GFTGARCEKDMDECSSTPCANGGRCRDQPGA

FYCECLPG GFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTG - UNI10535 - GQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGS

PGCVPAEDNCPCHHGHCQR RSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG GLTCSEEVTACHSGPCLNGGSCSIRPEGY

SCTCLPSHTGRHCQTAVDHCVSA ASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADS - UNI11180 - SPCRNKATCQDTPRGARCLCSP

GYTGSSCQ TLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQG GIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVN

PCEPNPCHHGSTCVPQPSGYVCQ CAPGYEGQNCSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACHSLANAFY

CQCLPGHTG GQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPK GFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTP

PAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCSLGVPDPWKGCPPHSQCWLLFRDGR

CHPQCDSEECLFDGYDCEIPLTCI IPAYDQYCRDHFHNGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLRVG

LWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAG GFVVVMGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPL

LPGPLLAAHPQAGTR RPSANQLPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPLGEDNIGLK KALKPEAEV

DEDGVAMCSGPEEGE AEETASASRCQLWPLNSGCGELPQAAMLTPPQECESEVLDVDTCGPD DGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEP

LLDRGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQ LLLASRQTTVDARTEDGTTPLMLAARLAVEDLV

EELIAARADVGARDKRG - UNI34156 - GKTALHWAAAVNNARAARSLLQAGADKDAQDSR EQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGL

APGDVARQRSHWDLLTLLEGAGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQARTWSVDLGARGGKVYARCRSRSGSCGGPTTRGRRFSAG

SRGRRGARASQDDWPRDWVALEACGSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVVRNLN

For any suggestions or comments, please send an email to unitrap@crg.es