Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015619 (Gata3)
Chromosomal location
Chr 2: 9779049 - 9800227 (-)
Description
GATA binding protein 3 Gene [Source:MGI (curated);Acc:Gata3-001]
RefSeq_dna
NM_008091 
RefSeq_peptide
NP_032117.1 
UniGene
Mm.313866 
MGI
MGI:95663 
Uniprot/SWISSPROT
P23772 
Uniprot/SPTREMBL
A2AS31 Q3TZD6 Q3TZS0 Q3U0R5 Q3U223 
Human Ortholog
ENSG00000107485 (GATA3)
Omim 146255 - HYPOPARATHYROIDISM, SENSORINEURAL DEAFNESS, AND RENAL DISEASE  
UniTrap UNI30640
Vector Insertion
Chr 2: 9779048 - 9784848
Public Clones (ggtc) IST10260E11 (tigm) IST11089G9 (tigm) IST12286E7 (tigm) IST12360C8 (tigm)
IST12360C8HMF1 (tigm) IST10716A4 (tigm) IST12431F8 (tigm) IST12916A8 (tigm)
IST11847H1 (tigm) IST12645A8 (tigm) IST10963H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102976
Sequence
AGCTGTCTGCGAACACTGAGCTGCCTGGCGCCGTCTTGATAGTTTCAGAAAGAATGCATTCCCTGTAAAAAAAAAATACTGAGAGAGGGAGAGGAGAAAG

AGAGAGAGACTGAGAGAGCGAGACATAGAGAGCTACGCAATCTGACCGGGCAGGTCACACGCCTCCTCCTCCTCCTCTACGCTCCTTGCTACTCAG GTG

ATCGGAAGAGCAACCGTCTCTGAGCGCCAAGGAATCAGTGTGCAGTGTGGTCACACTCGGATTCCTCTCTCCCTCCTTTTTTTTTTTTTTTTTTTGACCC

CTTTATTCCTCCGTGTCTGCTTTTTTTTTGGGGGGGGGGATCGCCCTCATTCTTTTCTTTTTCTTCTTTCCCTTCCTTTCTTTTGCTAAACTATCCCGCA

AAGATTTTTCTTTCCTCCCTAAACCCTCCTTTTTGCTCTCCTTTTCTATACCCTTAACTGCAAACAAACCATTAAACGACCCCTCTCCTGGGCCTCCGAC

GGCAGGAGTCCGCGGACCTCCCAGGCCGACAGCCCTCCCTCTACCCGCGAGGGTTCCGGGCCGGGCGAGAGGGCGCGAGCACAGCCGAGGACATGGAGGT

GACTGCGGACCAGCCGCGCTGGGTGAGCCACCATCACCCCGCGGTCCTCAACGGTCAGCACCCAGACACGCACCACCCGGGCCTCGGCCATTCGTACATG

GAAGCTCAGTATCCGCTGACGGAAGAGGTGGACGTACTTTTTAACATCGATGGTCAAGGCAACCACGTCCCGTCCTACTACGGAAACTCCGTCAGGGCTA

CGGTGCAGAGGTATCCTCCGACCCACCACG GGAGCCAGGTATGCCGCCCGCCTCTGCTGCACGGATCTCTGCCCTGGCTGGATGGCGGCAAAGCCCTGA

GCAGCCACCACACCGCCTCGCCCTGGAACCTCAGCCCCTTCTCCAAGACGTCCATCCACCACGGCTCTCCGGGGCCTCTGTCCGTTTACCCTCCGGCTTC

ATCCTCTTCTCTGGCGGCCGGCCACTCCAGTCCTCATCTCTTCACCTTCCCGCCCACCCCGCCGAAAGACGTCTCCCCAGACCCGTCGCTGTCCACCCCG

GGATCCGCCGGGTCGGCCAGGCAAGATGAGAAAGAGTGCCTCAAGTATCAGGTGCAGCTGCCAGATAGCATGAAGCTGGAGACGTCTCACTCTCGAGGCA

GCATGACCACCCTGGGTGGGGCCTCATCCTCAGCCCACCACCCCATTACCACCTATCCGCCCTATGTGCCCGAGTACAGCTCTGGACTCTTCCCACCCAG

CAGCCTGCTGGGAGGATCCCCTACCGGGTTCGGATGTAAGTCGAGGCCCAAGGCACGATCCAGCACAG AAGGCAGGGAGTGTGTGAACTGCGGGGCAAC

CTCTACCCCACTGTGGCGGCGAGATGGTACCGGGCACTACCTTTGCAATGCCTGCGGACTCTACCATAAAATGAATGGGCAGAACCGGCCCCTTATCAAG

CCCAAGCGAAGGCTG - UNI30640 - TCGGCAGCAAGGAGAGCAGGGACATCCTGCGCGAACTGTCAGACCACCACCACCACCCTCTGGAGGAGGAA

CGCTAATGGGGACCCGGTCTGCAATGCCTGTGGGCTGTACTACAAGCTTCATAAT - UNI30640 - ATTAACAGACCCCTGACTATGAAGAAAGAAG

GCATCCAGACCCGAAACCGGAAGATGTCTAGCAAATCGAAAAAGTGCAAAAAGGTGCATGACGCGCTGGAGGACTTCCCCAAGAGCAGCTCCTTCAACCC

GGCCGCTCTCTCCAGACACATGTCATCCCTGAGCCACATCTCTCCCTTCAGCCACTCCAGCCACATGCTGACCACACCGACGCCCATGCATCCGCCCTCC

GGCCTCTCCTTCGGACCTCACCACCCTTCCAGCATGGTCACCGCCATGGGTTAGAGAGGCAGAGCCCTGCTCCACATGCGTGAGGAGTCTCCAAGTGTGC

GAAGAGTTCCTCCGACCCCTTCTACTTGCGTTTTTCGCAGGAGCAGTATCATGAAGCCCGAAAGCGACAGATCTGTGTTTTTGAAGGCAGAAAGCAAAAT

GTTTGCTTCTTTTTTCAAAGGAGCTCGAGGTGGTGTCTGCATTCCAACCACTGAATCCGGATCCCATTTGTGAATAAGCCATTCAGACTCATATTCCCTA

TTTAACAGGGTCTCTAGTGCTGTGAAAAAAATATTGCTGAACATTGCATATAACTTATATTGTAAGAAATACTGTACATTTGAGGAAGACTTTATTGTAC

CTGGATAGCTGTAAGAAAGGCATGAAGGACGCCAAGAGTTTTAAGGAATATAGGGGGATTAAAGTATGGAGATACAGAAGAAACCACTAAGTCTGATGTC

CAAATGGGCACACTGTCAGTTTTGTTTCCCTTCAGTTGTTTGATGCATTTAAAAAAAAAAAAAAGAAAGAAAAAGAAAAAAAGGGGGGGGGGGGAGAAAA

AAATAAATTAAAAAAAAAAAAAAAAAAAGAAAAGAAAGAAAAATCTAAGAAAAAAAAAAAAAAGGTTGTAGGCAAATCATTTGTTCCAGGCTGTGAGCCT

GTGCAAAAGAGATTTCAGATCTGGGCAATGGGTGTGTGATCTCACCCACTGAAGATCTGAGAATGTCATGGCTAGGCCTACATGCTCTGTGAATCAGTCC

CTGTAATTGTTGTTTGTATGTATAATTCAGAAGCACCAAAATAAGAAAAGATGTAGATTTATTTCATCATATTATACAGACTGAATTGTTGTATAAATTT

ATTTACTGCTAGTGTTAGGAACTGCTTTTTTTTTTTTTTTTGGTTTTAATGTTTTTTTTTTTTTTGTTTTTTGTTTTTTTTTTTCTTTCTCTCTGGATTT

TT
Translation
 MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHG GSQVCRPPLLHGSLPWLD

GGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLET

SHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTE EGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG

QNRPLIKPKRRL - UNI30640 - SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN - UNI30640 - INRPLTMKKEGIQTRNRK

MSSKSKKCKKVHDALEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSGLSFGPHHPSSMVTAMG

For any suggestions or comments, please send an email to unitrap@crg.es