Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015647 (Lama5)
Chromosomal location
Chr 2: 179911078 - 179960564 (-)
Description
laminin, alpha 5 Gene [Source:MGI (curated);Acc:Lama5-001]
RefSeq_dna
NM_001081171 
RefSeq_peptide
NP_001074640.1 
UniGene
Mm.4339 
MGI
MGI:105382 
Uniprot/SWISSPROT
Q61001 
Uniprot/SPTREMBL
A2ABW7 Q3TZ05 Q712T9 Q80VE8 Q8R3Y7 Q6ZQA1 
Human Ortholog
ENSG00000130702 (LAMA5)
Omim not available
UniTrap UNI11494
Vector Insertion
Chr 2: 179960195 - 179960565
Public Clones G062F05 (ggtc) P073F05 (ggtc) P071B12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9493
Vector Insertion
Chr 2: 179943077 - 179955930
Public Clones RST053 (baygenomics) LST031 (baygenomics) P083C03 (ggtc) P077G01 (ggtc)
P080E10 (ggtc) P077C03 (ggtc) P085H04 (ggtc) P083C06 (ggtc) P080D11 (ggtc)
P076G11 (ggtc) P077C06 (ggtc) P084H07 (ggtc) G069F11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16308
Vector Insertion
Chr 2: 179942958 - 179943077
Public Clones not available
Private Clones OST463481 (lexicon) OST197635 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35768
Vector Insertion
Chr 2: 179942958 - 179956084
Public Clones IST14733B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9131
Vector Insertion
Chr 2: 179937213 - 179941429
Public Clones RST396 (baygenomics) RST397 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10134
Vector Insertion
Chr 2: 179933179 - 179933315
Public Clones XST124 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28306
Vector Insertion
Chr 2: 179931188 - 179931289
Public Clones not available
Private Clones OST34450 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10287
Vector Insertion
Chr 2: 179920671 - 179921266
Public Clones LST102 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9195
Vector Insertion
Chr 2: 179918440 - 179918722
Public Clones RST475 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015791
Sequence
ACTTGCCGGGCTCCTGCGGTGCGCGCTGTCCCTAGAGCCGCAGCCCCCAGCAGGAAAATGGCGAAGCGCGGAGGGCAGCTCTGCGCGGGGAGCGCACCGG

GCGCTCTTGGCCCCCGGAGCCCCGCGCCACGGCCGCTGCTACTGCTGCTGGCTGGACTGGCGCTGGTAGGCGAGGCGCGCACTCCCGGGGGCGATGGCTT

CAGCCTGCACCCGCCCTACTTCAACCTGGCGGAGGGCGCTCGCATCACCGCGTCCGCGACCTGCGGCGAGGAGGCCCCGACGCGCAGTGTCTCACGCCCC

ACCGAGGACCTCTACTGCAAGCTGGTTGGGGGTCCGGTGGCTGGCGGAGATCCCAATCAGACAATCCAG - UNI11494 - GGCCAGTACTGTGACAT

CTGTACAGCTGCCAACAGCAACAAGGCACACCCTGTGAGCAACGCCATCGATGGCACGGAGCGCTGGTGGCAGAGCCCACCCCTGTCCCGTGGCCTGGAG

TACAATGAGGTCAACGTCACACTGGACCTGGGCCAG - UNI9493 - - UNI16308 - GTGTTCCATGTGGCCTATGTGCTCATCAAGTTTGCCAA

CTCACCTCGGCCTGACCTCTGGGTGCTGGAGCGGTCCACAGACTTCGGTCACACTTATCAGCCGTGGCAGTTCTTTGCCT - UNI16308 - CCTCCA

AGAGGGATTGTTTGGAGCGGTTTGGACCTCGGACTCTAGAGCGCATCACGCAGGACGACGACGTCATCTGCACCACAGAATACTCGCGAATAGTGCCTTT

GGAGAATGGCGAG ATTGTGGTGTCCTTGGTAAATGGGCGCCCTGGGGCCTTGAACTTCTCCTACTCACCGTTACTTCGAGACTTCACCAAAGCCACCAA

CATCCGCTTGCGGTTTCTGCGAACCAACACGCTACTGGGCCACCTCATGGGCAAGGCGCTGCGGGACCCCACAGTCACCCGCAGG TATTATTACAGCAT

CAAAGACATCAGCATTGGTGGGCGCTGTGTCTGTCATGGCCACGCAGATGTCTGTGACGCCAAGGACCCATTGGATCCTTTCAG - UNI9131 - GCT

GCAGTGTGCCTGCCAGCACAATACATGTGGAGGCTCTTGTGACCGATGCTGTCCAGGCTTCAACCAGCAGCCGTGGAAGCCCGCCACCACGGACAGCGCC

AATGAGTGCCAGT CCTGCAATTGCCACGGCCATGCCTACGACTGTTACTACGACCCTGAGGTGGATCGGCGCAATGCCAGCCAGAACCAGGACAACGTG

TACCAGGGTGGAGGTGTCTGCCTGGATTGCCAG CATCACACTACGGGTATCAACTGTGAGCGTTGTCTGCCTGGCTTCTTCCGTGCCCCTGACCAGCCT

CTCGACTCACCTCATGTCTGTCGGC CCTGCGACTGTGAGTCAGACTTCACGGATGGGACCTGTGAAGACTTGACGGGCCGCTGTTACTGCAGGCCGAAC

TTCACAGGAGAGCTATGTGCTGCCTGCGCTGAGGGCTACACGGACTTCCCACACTGCTACC CTCTGCCTTCATTTCCCCACAATGACACGAGAGAACAG

GTGCTTCCCGCTGGACAAATCGTGA ACTGTGATTGCAATGCTGCAGGGACCCAGGGCAATGCCTGCCGGAAGGACCCAAGGTTGGGACGGTGTGTCTGC

AAACCCAACTTCCGGGGTGCCCACTGTGAGCTCTGTGCTCCTGGATTCCACGGGCCTAGCTGCCACC CATGCCAGTGTTCCAGCCCTGGGGTAGCCAAC

AGCCTCTGTGACCCAGAGTCTGGCCAGTGCATGTGCCGCACCGGCTTTGAGGGGGACAGGTGTGACCACTGTGCCCTTGGCTATTTCCACTTCCCTCTCT

GTCAGC TGTGTGGCTGCAGCCCAGCAGGGACCTTGCCTGAAGGCTGTGACGAGGCTGGCCGCTGCCAGTGCCGACCTGGCTTTGACGGTCCTCACTGTG

ACCGATGCCTTCCAGGATACCATGGGTATCCCGACTGTCACG - UNI10134 - CTTGTGCCTGTGACCCTCGGGGGGCCCTGGATCAGCAGTGTGGA

GTGGGCGGTTTGTGCCACTGCCGTCCTGGCTACACAGGTGCCACTTGTCAGGAATGTAGCCCCGGCTTCTACGGCTTCCCCAGCTGCATCC - UNI101

34 - CCTGCCACTGCTCTGCCGATGGCTCCTTGCATACAACCTGTGACCCGACAACCGGCCAGTGTAGGTGTCGACCCCGAGTGACAGGACTACATTGT

GATATGTGTGTACCAGGCGCCTATAACTTCCCCTACTGTGAAG CTGGCTCTTGTCATCCTGCTGGTCTGGCCCCAGCCAATCCTGCCCTTCCTGAG AC

ACAGGCTCCCTGTATGTGCCGGGCTCACGTGGAAGGGCCAAGCTGTGATCGCTGTAAACCTGGGTACTGGGGGCTGAGCGCCAGCAACCCTGAAGGCTGC

ACAC GCTGCAGCTGTGACCCACGAGGCACCCTGGGTGGAGTTACTGAGTGCCAG GGCAATGGGCAGTGCTTCTGCAAGGCTCACGTGTGTGGCAAGAC

CTGTGCAGCCTGCAAGGATGGCTTCTTTGGCCTGGATTATGCTGACTACTTTGGCTGCCGTA - UNI28306 - GCTGTAGGTGTGATGTTGGTGGTG

CCCTGGGTCAAGGCTGTGAACCAAAGACAGGTGCCTGCAGGTGCCGCCCTAACACCCAAGGACCCACCTGTAGCGA - UNI28306 - GCCAGCGAAG

GACCACTACTTGCCAGACCTGCACCACATGCGGCTGGAACTAGAGGAGGCGGCCACTCCCGAGGGCCACGCTGTACGCTTTGGCTTCAACCCCCTGGAGT

TTGAGAACTTTAGCTGGAGAGGCTACGCACACATGATGGCTATCCAG CCCAGGATTGTGGCCAGGCTGAACGTGACCTCCCCTGACCTCTTTCGGCTGG

TTTTCCGATATGTCAACCGTGGATCAACCAGCGTGAATGGGCAGATCTCTGTTCGTGAAGAGGGCAAGCTTTCCAGCTGTACCAACT GCACAGAGCAGA

GCCAGCCAGTGGCTTTCCCACCCAGCACTGAGCCTGCCTTTGTCACTGTGCCCCAGAGGGGCTTTGGGGAACCCTTTGTGCTGAACCCCGGCATCTGGGC

CTTGCTGGTCGAGGCTGAAGGTGTACTCTTG GACTACGTGGTCCTACTGCCCAGCACCTACTATGAGGCAGCTCTCCTACAGCATCGAGTAACGGAGGC

CTGTACCTACCGTCCCTCAGCCCTGCACTCCACAGAGAA CTGTCTTGTCTATGCTCACCTACCCCTGGATGGCTTCCCTTCAGCAGCTGGAACTGAGGC

CCTGTGTCGCCATGACAACAGCCTGCCCCGGCCCTGCCCCACAGAGCAGCTCAGCCCCTCACACCCACCGCTGGCGACCTGCTTCGGCAGTGAT GTGGA

CATCCAGCTCGAGATGGCCGTGCCTCAGCCTGGCCAATATGTTCTCGTGGTGGAATATGTCGGTGAGGATTCACACCAAGAGATGGGAGTGGCTGTGCAC

ACCCCTCAGAGAGCCCCCCAGCAAGGGGTGCTCAACCTCCACCCCTGCCCATACAG CTCCCTGTGCCGGAGTCCGGCTCGGGACACCCAGCATCATCTA

GCCATCTTCTACCTGGACTCTGAGGCTAGCATCCGGCTCACAGCTGAGCAAGCTCACTTCTTCCTG CACAGCGTCACCCTGGTACCTGTGGAGGAGTTC

AGTACTGAGTTTGTGGAGCCCCGGGTCTTCTGTGTGAGCAGTCATGGAACTTTCAACCCCAGCAG TGCTGCCTGTCTAGCCTCCCGATTCCCGAAGCCA

CCGCAGCCCATCATCCTTAAGGACTGCCAGGTCTTGCCGCTGCCTCCCGACCTGCCTCTGACTCAGTCTCAGGAGCTCTCACCAGGTGCACCCCCCGAGG

GACCACAGCCTCGGCCGCCAACTGCGGTGGATCCTAATGCAGAACCCACCTTGCTGCGCCACCCCCAG GGCACGGTGGTCTTCACCACCCAGGTGCCCA

CCCTGGGCCGCTATGCCTTTCTGCTGCACGGCTACCAGCCGGTCCACCCCTCCTTCCCTGTGGAGGTACTCATTAATGGTGGCCGCATCTGGCAGG GCC

ACGCCAACGCCAGCTTTTGTCCTCATGGTTATGGCTGCCGTACCCTGGTGTTGTGTGAGGGTCAGACGATGCTGGATGTTACAGACAACGAGCTCACCGT

GACTGTGCGTGTGCCAGAAGGCCGGTGGCTCTGGCTG GACTACGTACTCATTGTCCCTGAGGATGCTTACAGCTCCAGTTACCTCCAAGAGGAGCCTTT

GGACAAATCCTATGACTTCATCAGCCACTGTGCCACCCAGGGCTACCACATTAG CCCCAGCAGCTCATCTCCATTCTGCCGGAATGCCGCCACCTCCTT

GTCTCTCTTCTACAACAACGGGGCCCTCCCTTGTGGCTGCCACGAGGTGGGTGCCGTAAGCCCCACGTGCGAGCCCTTCGGGGGCCAGTGTCCCTGCCGG

GGCCACGTTATTGGCCGTGACTGTTCCCGCTGTGCCACCGGCTACTGGGGTTTCCCCAACTGCAGGC CCTGTGACTGTGGAGCCCGCCTGTGTGACGAG

CTCACGGGCCAGTGTATCTGTCCACCACGCACTGTTCCCCCTGACTGCTTGGTCTGCCAGCCACAGAGCTTTGGTTGCCACCCCTTGGTGGGCTGTGAGG

AGTGTAACTGCTCAGGGCCCGGCGTCCAGGAGCTGACGGACCCTACCTGTGACATGGACAGCGGCCAGTGCAG ATGCAGACCCAATGTAGCTGGACGTC

GCTGTGATACCTGTGCCCCGGGCTTCTATGGCTATCCTAGCTGTCGCCCCTGTGACTGCCATGAGGCAGGCACCATGGCTAGCGTGTGTGACCCCCTCAC

AGGCCAATGCCATTGCAAG GAGAACGTGCAGGGCTCAAGATGTGACCAGTGTCGCGTGGGGACCTTCTCCTTGGATGCTGCTAACCCCAAGGGCTGTAC

CCGCTGCTTCTGTTTCGGGGCCACAGAGCGCTGTGGGAACTCTAACCTCGCCCGCCATGAG TTCGTGGACATGGAGGGCTGGGTGCTGTTGAGCAGTGA

CCGGCAGGTGGTACCCCACGAGCATCGGCCTGAGATAGAGCTGCTGCACGCAGATCTGCGCTCTGTGGCTGACACTTTCTCAGAGCTGTACTGGCAGGCT

CCGCCCTCCTATCTGGGAGACAGG GTGTCATCCTACGGTGGAACCCTCCACTATGAGCTGCACTCAGAGACCCAGCGAGGTGATATCTTCATTCCCTAC

GAGAGCCGGCCGGACGTCGTGCTGCAG GGCAACCAAATGAGCATCGCCTTCCTGGAACTGGCGTACCCTCCGCCTGGCCAGGTTCACCGAGGACAGCTA

CAGCTGGTAGAG GGGAACTTCCGGCACTTGGAGACTCACAACCCCGTGTCCCGAGAAGAACTCATGATGGTGCTGGCCGGCCTGGAGCAGCTGCAGATC

CGTGCTCTCTTCTCGCAGACCTCTTCCAGTGTCTCCTTGCGTAGAGTGGTACTGGAGGTGGCTAGCGAGGCTGGTAGGGGGCCTCCAGCCAGCAATGTGG

AACTGTGTATGTGCCCTGCCAACTACCGTGGGGACTCGTGCCAG GAATGTGCCCCTGGCTATTACCGGGACACCAAGGGTCTCTTCCTAGGCCGATGTG

TCCCCTGTCAGTGCCATGGCCATTCAGATCGCTGCCTTCCTGGCTCTGGCATTTGTGTG GGCTGCCAGCACAACACAGAAGGGGACCAATGTGAGCGCT

GTAGGCCTGGCTTTGTCAGCAGTGATCCCAGTAACCCTGCATCCCCATGTGTGAGCTGCCCTTGCCCCTTGGCAGTGCCCTCCAATAA TTTTGCAGACG

GTTGCGTCTTAAGAAATGGCCGAACCCAGTGCCTCTGCAGGCCAGGCTATGCTGGTGCCTCCTGCGAGCG GTGTGCACCTGGCTTTTTTGGGAACCCCC

TGGTGCTAGGCAGCTCCTGTCAGCCCTGCGACTGCAGCGGTAATGGAGACCCCAACATGATCTTCAGTGACTGCGACCCCCTGACGGGTGCCTGTCGAGG

CTGCCTCCGTCACACCACTGGGCCCCACTGTGAACGCTGTGCCCCAGGCTTCTATGGCAATGCTTTGTTGCCAGGCAACTGCACCC GGTGTGACTGTTC

CCCATGTGGGACAGAAACCTGTGATCCCCAGAGTGGACGCTGCCTGTGCAAAGCAGGCGTGACTGGACAACGTTGTGACCGCTGTTTG GAAGGATACTT

CGGTTTTGAGCAATGCCAGGGCTGCCGCCCTTGTGCCTGTGGACCAGCTGCCAAGGGCTCCGAGTGCCACCCTCAGAGCGGTCAGTGTCACTGCCAGCCA

GGGACCACAGGACCCCAGTGCCTCGAGTGCGCCCCTGGCTACTGGGGCCTCCCAGAGAAGGGCTGCAGGC GCTGCCAGTGTCCCCGAGGCCACTGTGAC

CCACACACGGGCCACTGCACCTGTCCCCCGGGGCTCAGCGGGGAACGCTGTGACACCTGCAGCCAGCAGCACCAGGTGCCTGTACCGGGCAAGCCTGGGG

GCCATGGCATACACTGTGAAG - UNI10287 - TGTGTGACCACTGTGTGGTTCTCCTTCTGGATGACCTCGAGCGGGCTGGTGCCCTCCTCCCCGCT

ATCCGTGAGCAGCTGCAGGGTATCAATGCCAGCTCCGCGGCCTGGGCCAGGCTGCACAGGCTGAATGCCTCCATTGCTGACCTGCAG AGTAAACTCCGG

AGCCCACCGGGACCCCGCTACCAGGCAGCACAGCAGCTACAGACTCTAGAGCAGCAGAGTATAAGCCTTCAACAGGACACGGAGAGGCTGGGCAGTCAG 

GCCACAGGGGTCCAAGGTCAGGCAGGCCAGCTACTGGACACCACAGAGTCCACACTGGGCCGGGCACAGAAGTTGTTGGAGTCTGTGCGAGCTGTGGGCC

GTGCCCTGAATG AGCTGGCATCTCGCATGGGCCAAGGATCTCCAGGCGATGCCTTGGTACCGTCTGGCGAGCAGCTGCGCTGGGCTCTGGCTGAAGTGG

AGCGGCTGCTCTGGGATATGCGGACGCGTGACCTGGGGGCCCAGGGGGCAGTGGCAGAGGCCGAACTGGCCGAAGCCCAGAGGC TGATGGCTCGTGTCC

AGGAGCAGCTGACCAGCTTCTGGGAGGAGAACCAGTCATTGGCCACACACATTCGGGACCAGCTGGCTCAGTATGAGTCTGGCCTCATGGATCTTCGTGA

GGCCCTGAACCAGGCCGTTAATACCACCCGGGAGGCTGAGGAACTCAACAGCCGCAACCAGGAACGGCTGAAGGAAGCCCTG - UNI9195 - CAATG

GAAACAGGAACTGTCCCAGGACAATGCCACCCTGAAGGCCACTCTTCAAGCTGCCAGTCTCATCTTGGGCCATGTTTCTGAGCTTCTGCAGGGCATAGAC

CAGGCTAAGGAG GACCTAGAGCACCTGGCGGCCAGCCTGGATGGAGCCTGGACACCCTTACTGAAGAGGATGCAGGCCTTTTCCCCTGCCAGCAGCAAG

GTGGACTTGGTAGAGGCTGCTGAGGCCCACGCTCAGAAGCTGAACCAGCTGGCAATCAACCTGTCTGG CATCATCCTTGGCATCAATCAGGACCGCTTC

ATCCAGAGGGCTGTGGAAGCCTCCAATGCCTACAGCAGCATCCTTCAGGCCGTTCAGGCTGCCGAGGATGCGGCAGGCCAGGCACTGAGGCAGGCCAGCC

GCACATGGGAG ATGGTGGTGCAGCGGGGCCTAGCAGCTGGAGCCCGGCAGCTGTTAGCCAACAGCAGTGCCCTGGAGGAGACCATCCTTGGACACCAGG

GGAGGCTGGGCCTTG CTCAGGGCCGTCTGCAGGCTGCGGGGATCCAGCTTCATAATGTCTGGGCCAGGAAGAACCAGCTAGCAGCCCAGATCCAGGAGG

CACAAGCCATGCTGGCCATGGACACGA GCGAGACCAGTGAGAAGATTGCTCACGCCAAGGCTGTGGCTGCCGAAGCCCTCAGTACGGCCACCCACGTGC

AGTCTCAGCTTCAGGGTATGCAGAAGAATGTGGAGAGGTGGCAGAGCCAGCTGGGAGGCCTGCAAGGCCAGGACCTGAGCCAGGTGGAACGGGATGCAAG

CAGTTCAG TGTCCACCCTGGAGAAGACATTGCCACAGCTGCTGGCCAAACTGAGCCGTCTAGAGAACCGTGGAGTTCACAATGCCAGCCTGGCTTTGTC

TGCCAACATTGGTCGTGTGCGCAAGCTCATTGCCCAAGCCCGGAGTGCCGCCAGCAAG GTCAAGGTGTCCATGAAGTTCAATGGGCGTTCAGGGGTACG

ACTGCGTACCCCACGAGACCTTGCCGACCTTGCTGCGTACACTGCCCTCAAGTTCCACATCCAGAGCCCAGTGCCAGCGCCCGAACCTGGCAAGAACACG

GGGGACCACTTTGTTCTGTACATGGGCAGCCGCCAG GCCACTGGGGACTACATGGGAGTGTCTCTGCGTAATCAGAAGGTGCACTGGGTGTACAGGCTA

GGAAAGGCTGGCCCCACAACTCTCAGCATCGACGAGAACATCGGGGAGCAGTTTGCAGCCGTCAGCATCGACAG GACCCTCCAGTTTGGCCACATGTCT

GTCACCGTGGAGAAACAGATGGTTCATGAGATCAAGGGAGACACGGTGGCCCCTGGGAGCGAGGGACTACTCAACCTGCATCCTGACGATTTTGTCTTCT

ACGTGGGAGGATACCCCAGCAACTTCACG CCCCCTGAACCCCTCCGATTCCCTGGCTACCTGGGCTGCATTGAGATGGAAACACTGAATGAGGAGGTGG

TCAGCCTCTACAATTTTGAGCAGACCTTCATGCTGGACACGGCAGTAGATAAACCTTGTGCTCG CTCCAAGGCCACCGGTGACCCATGGCTCACAGATG

GCTCCTACCTGGATGGCAGTGGCTTTGCCCGCATCAGCTTTGAGAAGCAGTTCAGCAACACAAAACGCTTTGACCAGGAGCTGCGGCTTGTGTCCTACAA

TGGGATCATCTTTTTCCTCAAGCAAGAG AGCCAGTTCTTGTGCCTGGCAGTGCAGGAAGGCACCCTGGTGCTCTTCTATGACTTCGGCTCTGGCCTGAA

GAAGGCCGACCCACTGCAGCCCCCACAAGCCTTGACGGCAGCCAGCAAGGCG ATCCAAGTGTTTCTATTGGCTGGCAATCGCAAACGTGTGTTGGTGCG

TGTGGAGCGGGCCACTGTGTTCAGCGTAGACCAGGATAACATGCTGGAGATGGCTGATGCCTACTACTTGGGAGGTGTGCCACCTGAACAGCTGCCCTTG

AG CCTACGGCAGCTCTTCCCCTCCGGAGGCTCTGTCCGTGGCTGCATCAAGGGTATTAAGGCTCTGGGCAAGTACGTGGACCTCAAACGGTTGAACACC

ACGGGCATCAGTTTCGGCTGCACCGCTGACCTGCTAGTGGGACGCACCATGACTTTTCACGGCCACGGCTTCCTGCCCCTGGCACTTCCTGATGTGGCAC

CCATCACCGAAGTGGTCTATTCTGGCTTTGGCTTTCGTGGCACCCAGGACAACAACCTGCTGTATTACCGTACCTCCCCG GATGGGCCGTACCAGGTAT

CCCTGAGGGAGGGCCACGTGACACTCCGTTTTATGAACCAAGAGGTGGAAACTCAAAGGGTCTTTGCTGATGGTGCTCCTCACTATGTTGCCTTCTATAG

CAATGTCACAGG GGTATGGCTGTATGTGGATGACCAGCTACAACTAGTAAAGTCTCATGAGAGAACAACTCCCATGCTCCAACTACAGCCCGAGGAACC

CTCACGGCTTCTCCTGGGAGGCCTGCCTGTGTCTGGTACCTTCCACAACTTCAGTGGCTGCATCAGCAATGTTTTTGTACAGCG ACTTCGGGGACCACA

GCGTGTGTTTGACCTACACCAGAACATGGGGAGTGTCAATGTAAGCGTAGGCTGTACACCAGCCCAACTCATCGAGACCTCAAGGGCCACGGCTCAGAAG

 GTTTCCCGCCGTAGTCGACAACCCAGCCAGGACCTTGCCTGCACGACACCCTGGCTCCCTGGGACTATTCAGGATGCATACCAGTTTGGGGGACCCCTG

CCCAGTTACCTACAGTTTGTGGGTATCTCTCCGTCCCACAGGAATAG GCTCCACCTCTCCATGCTTGTCCGTCCACATGCGGCTTCCCAGGGCCTCCTG

CTCTCTACAGCCCCCATGTCGGGCCGCAGCCCTTCGTTGGTACTCTTTCTAAACCATGGACACTTTGTCGCACAGACTGAGGGCCCTGGGCCCCGGCTCC

AGGTCCAGAGTCGCCAGCACTCACGGGCTGGCCAGTGGCACAGG GTGTCCGTCCGCTGGGGAATGCAGCAGATCCAGCTTGTGGTGGACGGCAGCCAGA

CCTGGAGCCAGAAGGCTCTCCACCATCGGGTCCCCAGGGCAGAGCGACCACAGCCCTACACCCTCTCTGTAGGAGGTCTTCCTGCCAGCAGTTACAGTTC

CAAGCTCCCT GTGTCTGTGGGGTTCAGCGGCTGTCTGAAGAAATTACAGCTGGATAAGCGGCCACTGAGGACCCCAACGCAAATGGTGGGGGTCACACC

CTGTGTCTCAGGCCCCCTGGAAGATGGCCTGTTCTTCCCAGGCAGTGAGGGAGTTGTCACATTAG AGCTCCCCAAGGCCAAGATGCCCTATGTGAGCCT

GGAGCTAGAGATGCGGCCCTTGGCAGCTGCTGGCCTCATCTTCCACCTGGGCCAGGCCCTGGCCACTCCCTACATGCAGCTGAAGGTGCTGACAGAACAG

 GTCCTGCTGCAGGCAAATGATGGGGCAGGGGAGTTTTCCACGTGGGTGACCTACCCCAAGCTTTGTGATGGACGGTGGCACCGAGTGGCAG TGATCAT

GGGCAGGGACACACTCCGGCTGGAGGTAGACACACAGAGCAACCACACCACAGGCCGTTTGCCAGAGAGCTTGGCTGGTTCTCCAGCACTTCTGCACCTC

GGGAGCCTGCCCA AGTCTTCAACTGCTCGGCCAGAGCTCCCTGCCTACCGAGGATGCTTGAGGAAGCTGCTGATCAATGGGGCCCCTGTCAACGTGACT

GCTTCTGTACAAATCCAGGGGGCAGTGGGGATGCGCGGATGCCCCTCAGGAACCCTAGCACTTTCCAAGCAGGGAAAGGCACTGACCCAGAGGCAGGCCA

AGCCCAGTGTCTCCCCGCTACTTTGGCATTGAGGGTTCCCAGACCTTGGGGTTTGCCTACACTTTCTATGAATAACAAGTCATTTCTGGTTTACACTGTC

TTTTTAGAGGAAAAGGACTCTGTAGAACAGATATTATATTTATACTTTGTTCCTCCTGCCCAACAACTGTCAGTACTGAGATCTGAAATTAAAATGACTT

GTTTGA
Translation
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEGARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPN

QTIQ - UNI11494 - GQYCDICTAANSNKAHPVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQ - UNI9493 - - UNI16308 - VFHVA

YVLIKFANSPRPDLWVLERSTDFGHTYQPWQFFAS - UNI16308 - SSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGE IVVSLVNGRP

GALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRR YYYSIKDISIGGRCVCHGHADVCDAKDPLDPFR - UNI9131 - RLQCAC

QHNTCGGSCDRCCPGFNQQPWKPATTDSANECQS SCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQ HHTTGINCERCLPGFFRAPDQPLD

SPHVCRP PCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYP PLPSFPHNDTREQVLPAGQIVN NCDCNAAGTQGNACRKDPRLGR

CVCKPNFRGAHCELCAPGFHGPSCHP PCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQL LCGCSPAGTLPEGCDEAGRCQCRPG

FDGPHCDRCLPGYHGYPDCHA - UNI10134 - ACACDPRGALDQQCGVGGLCHCRPGYTGATCQECSPGFYGFPSCIP - UNI10134 - PCHCS

ADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGAYNFPYCEA AGSCHPAGLAPANPALPE TQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCTR R

CSCDPRGTLGGVTECQ GNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRS - UNI28306 - SCRCDVGGALGQGCEPKTGACRCRPNTQGPTCS

E - UNI28306 - EPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNPLEFENFSWRGYAHMMAIQ PRIVARLNVTSPDLFRLVFRYVNRGSTSVNG

QISVREEGKLSSCTNC CTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLL DYVVLLPSTYYEAALLQHRVTEACTYRPSALHST

EN NCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPCPTEQLSPSHPPLATCFGSD VDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAPQQG

VLNLHPCPYS SSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFL HSVTLVPVEEFSTEFVEPRVFCVSSHGTFNPSS SAACLASRFPKPPQPII

LKDCQVLPLPPDLPLTQSQELSPGAPPEGPQPRPPTAVDPNAEPTLLRHPQ GTVVFTTQVPTLGRYAFLLHGYQPVHPSFPVEVLINGGRIWQG GHAN

ASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWL DYVLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHIS SPSSSSPFCRNAATSL

SLFYNNGALPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRP PCDCGARLCDELTGQCICPPRTVPPDCLVCQPQSFGCHPLVGC

EECNCSGPGVQELTDPTCDMDSGQCR RCRPNVAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCK ENVQGSRCDQCRVGTFSLDAANP

KGCTRCFCFGATERCGNSNLARHE FVDMEGWVLLSSDRQVVPHEHRPEIELLHADLRSVADTFSELYWQAPPSYLGDR VSSYGGTLHYELHSETQRGD

IFIPYESRPDVVLQ GNQMSIAFLELAYPPPGQVHRGQLQLVE GNFRHLETHNPVSREELMMVLAGLEQLQIRALFSQTSSSVSLRRVVLEVASEAGRG

PPASNVELCMCPANYRGDSCQ ECAPGYYRDTKGLFLGRCVPCQCHGHSDRCLPGSGICV GCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLAV

PSNN NFADGCVLRNGRTQCLCRPGYAGASCER RCAPGFFGNPLVLGSSCQPCDCSGNGDPNMIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNAL

LPGNCTR RCDCSPCGTETCDPQSGRCLCKAGVTGQRCDRCL EGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQCLECAPGYWGLPEK

GCRR RCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPGGHGIHCEV - UNI10287 - VCDHCVVLLLDDLERAGALLPAIREQLQGI

NASSAAWARLHRLNASIADLQ SKLRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQ ATGVQGQAGQLLDTTESTLGRAQKLLESVRAVGRALNE E

LASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVAEAELAEAQRL LMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALN

QAVNTTREAEELNSRNQERLKEAL - UNI9195 - QWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKE DLEHLAASLDGAWTPLLKRMQAF

SPASSKVDLVEAAEAHAQKLNQLAINLSG GIILGINQDRFIQRAVEASNAYSSILQAVQAAEDAAGQALRQASRTWE MVVQRGLAAGARQLLANSSAL

EETILGHQGRLGLA AQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTS SETSEKIAHAKAVAAEALSTATHVQSQLQGMQKNVERWQSQLGGLQ

GQDLSQVERDASSSV VSTLEKTLPQLLAKLSRLENRGVHNASLALSANIGRVRKLIAQARSAASK VKVSMKFNGRSGVRLRTPRDLADLAAYTALKFH

IQSPVPAPEPGKNTGDHFVLYMGSRQ ATGDYMGVSLRNQKVHWVYRLGKAGPTTLSIDENIGEQFAAVSIDR RTLQFGHMSVTVEKQMVHEIKGDTVA

PGSEGLLNLHPDDFVFYVGGYPSNFT PPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCAR RSKATGDPWLTDGSYLDGSGFARISFE

KQFSNTKRFDQELRLVSYNGIIFFLKQE SQFLCLAVQEGTLVLFYDFGSGLKKADPLQPPQALTAASKA IQVFLLAGNRKRVLVRVERATVFSVDQDN

MLEMADAYYLGGVPPEQLPLS SLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCTADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGF

RGTQDNNLLYYRTSP DGPYQVSLREGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTG GVWLYVDDQLQLVKSHERTTPMLQLQPEEPSRLLLGGLP

VSGTFHNFSGCISNVFVQR RLRGPQRVFDLHQNMGSVNVSVGCTPAQLIETSRATAQK VSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFV

GISPSHRNR RLHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRAGQWHR VSVRWGMQQIQLVVDGSQTWSQK

ALHHRVPRAERPQPYTLSVGGLPASSYSSKLP VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLE ELPKAKMPYVSLEL

EMRPLAAAGLIFHLGQALATPYMQLKVLTEQ VLLQANDGAGEFSTWVTYPKLCDGRWHRVAV VIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHL

GSLPK KSSTARPELPAYRGCLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
Transcript ENSMUST00000087542
Sequence
ACTTGCCGGGCTCCTGCGGTGCGCGCTGTCCCTAGAGCCGCAGCCCCCAGCAGGAAAATGGCGAAGCGCGGAGGGCAGCTCTGCGCGGGGAGCGCACCGG

GCGCTCTTGGCCCCCGGAGCCCCGCGCCACGGCCGCTGCTACTGCTGCTGGCTGGACTGGCGCTGGTAGGCGAGGCGCGCACTCCCGGGGGCGATGGCTT

CAGCCTGCACCCGCCCTACTTCAACCTGGCGGAGGGCGCTCGCATCACCGCGTCCGCGACCTGCGGCGAGGAGGCCCCGACGCGCAGTGTCTCACGCCCC

ACCGAGGACCTCTACTGCAAGCTGGTTGGGGGTCCGGTGGCTGGCGGAGATCCCAATCAGACAATCCAG - UNI11494 - GGCCAGTACTGTGACAT

CTGTACAGCTGCCAACAGCAACAAGGCACACCCTGTGAGCAACGCCATCGATGGCACGGAGCGCTGGTGGCAGAGCCCACCCCTGTCCCGTGGCCTGGAG

TACAATGAGGTCAACGTCACACTGGACCTGGGCCAG - UNI9493 - - UNI16308 - GTGTTCCATGTGGCCTATGTGCTCATCAAGTTTGCCAA

CTCACCTCGGCCTGACCTCTGGGTGCTGGAGCGGTCCACAGACTTCGGTCACACTTATCAGCCGTGGCAGTTCTTTGCCT - UNI16308 - CCTCCA

AGAGGGATTGTTTGGAGCGGTTTGGACCTCGGACTCTAGAGCGCATCACGCAGGACGACGACGTCATCTGCACCACAGAATACTCGCGAATAGTGCCTTT

GGAGAATGGCGAG ATTGTGGTGTCCTTGGTAAATGGGCGCCCTGGGGCCTTGAACTTCTCCTACTCACCGTTACTTCGAGACTTCACCAAAGCCACCAA

CATCCGCTTGCGGTTTCTGCGAACCAACACGCTACTGGGCCACCTCATGGGCAAGGCGCTGCGGGACCCCACAGTCACCCGCAGG TATTATTACAGCAT

CAAAGACATCAGCATTGGTGGGCGCTGTGTCTGTCATGGCCACGCAGATGTCTGTGACGCCAAGGACCCATTGGATCCTTTCAG - UNI9131 - GCT

GCAGTGTGCCTGCCAGCACAATACATGTGGAGGCTCTTGTGACCGATGCTGTCCAGGCTTCAACCAGCAGCCGTGGAAGCCCGCCACCACGGACAGCGCC

AATGAGTGCCAGT CCTGCAATTGCCACGGCCATGCCTACGACTGTTACTACGACCCTGAGGTGGATCGGCGCAATGCCAGCCAGAACCAGGACAACGTG

TACCAGGGTGGAGGTGTCTGCCTGGATTGCCAG CATCACACTACGGGTATCAACTGTGAGCGTTGTCTGCCTGGCTTCTTCCGTGCCCCTGACCAGCCT

CTCGACTCACCTCATGTCTGTCGGC CCTGCGACTGTGAGTCAGACTTCACGGATGGGACCTGTGAAGACTTGACGGGCCGCTGTTACTGCAGGCCGAAC

TTCACAGGAGAGCTATGTGCTGCCTGCGCTGAGGGCTACACGGACTTCCCACACTGCTACC CTCTGCCTTCATTTCCCCACAATGACACGAGAGAACAG

GTGCTTCCCGCTGGACAAATCGTGA ACTGTGATTGCAATGCTGCAGGGACCCAGGGCAATGCCTGCCGGAAGGACCCAAGGTTGGGACGGTGTGTCTGC

AAACCCAACTTCCGGGGTGCCCACTGTGAGCTCTGTGCTCCTGGATTCCACGGGCCTAGCTGCCACC CATGCCAGTGTTCCAGCCCTGGGGTAGCCAAC

AGCCTCTGTGACCCAGAGTCTGGCCAGTGCATGTGCCGCACCGGCTTTGAGGGGGACAGGTGTGACCACTGTGCCCTTGGCTATTTCCACTTCCCTCTCT

GTCAGC TGTGTGGCTGCAGCCCAGCAGGGACCTTGCCTGAAGGCTGTGACGAGGCTGGCCGCTGCCAGTGCCGACCTGGCTTTGACGGTCCTCACTGTG

ACCGATGCCTTCCAGGATACCATGGGTATCCCGACTGTCACG - UNI10134 - CTTGTGCCTGTGACCCTCGGGGGGCCCTGGATCAGCAGTGTGGA

GTGGGCGGTTTGTGCCACTGCCGTCCTGGCTACACAGGTGCCACTTGTCAGGAATGTAGCCCCGGCTTCTACGGCTTCCCCAGCTGCATCC - UNI101

34 - CCTGCCACTGCTCTGCCGATGGCTCCTTGCATACAACCTGTGACCCGACAACCGGCCAGTGTAGGTGTCGACCCCGAGTGACAGGACTACATTGT

GATATGTGTGTACCAGGCGCCTATAACTTCCCCTACTGTGAAG CTGGCTCTTGTCATCCTGCTGGTCTGGCCCCAGCCAATCCTGCCCTTCCTGAG AC

ACAGGCTCCCTGTATGTGCCGGGCTCACGTGGAAGGGCCAAGCTGTGATCGCTGTAAACCTGGGTACTGGGGGCTGAGCGCCAGCAACCCTGAAGGCTGC

ACAC GCTGCAGCTGTGACCCACGAGGCACCCTGGGTGGAGTTACTGAGTGCCAG GGCAATGGGCAGTGCTTCTGCAAGGCTCACGTGTGTGGCAAGAC

CTGTGCAGCCTGCAAGGATGGCTTCTTTGGCCTGGATTATGCTGACTACTTTGGCTGCCGTA - UNI28306 - GCTGTAGGTGTGATGTTGGTGGTG

CCCTGGGTCAAGGCTGTGAACCAAAGACAGGTGCCTGCAGGTGCCGCCCTAACACCCAAGGACCCACCTGTAGCGA - UNI28306 - GCCAGCGAAG

GACCACTACTTGCCAGACCTGCACCACATGCGGCTGGAACTAGAGGAGGCGGCCACTCCCGAGGGCCACGCTGTACGCTTTGGCTTCAACCCCCTGGAGT

TTGAGAACTTTAGCTGGAGAGGCTACGCACACATGATGGCTATCCAG CCCAGGATTGTGGCCAGGCTGAACGTGACCTCCCCTGACCTCTTTCGGCTGG

TTTTCCGATATGTCAACCGTGGATCAACCAGCGTGAATGGGCAGATCTCTGTTCGTGAAGAGGGCAAGCTTTCCAGCTGTACCAACT GCACAGAGCAGA

GCCAGCCAGTGGCTTTCCCACCCAGCACTGAGCCTGCCTTTGTCACTGTGCCCCAGAGGGGCTTTGGGGAACCCTTTGTGCTGAACCCCGGCATCTGGGC

CTTGCTGGTCGAGGCTGAAGGTGTACTCTTG GACTACGTGGTCCTACTGCCCAGCACCTACTATGAGGCAGCTCTCCTACAGCATCGAGTAACGGAGGC

CTGTACCTACCGTCCCTCAGCCCTGCACTCCACAGAGAA CTGTCTTGTCTATGCTCACCTACCCCTGGATGGCTTCCCTTCAGCAGCTGGAACTGAGGC

CCTGTGTCGCCATGACAACAGCCTGCCCCGGCCCTGCCCCACAGAGCAGCTCAGCCCCTCACACCCACCGCTGGCGACCTGCTTCGGCAGTGAT GTGGA

CATCCAGCTCGAGATGGCCGTGCCTCAGCCTGGCCAATATGTTCTCGTGGTGGAATATGTCGGTGAGGATTCACACCAAGAGATGGGAGTGGCTGTGCAC

ACCCCTCAGAGAGCCCCCCAGCAAGGGGTGCTCAACCTCCACCCCTGCCCATACAG CTCCCTGTGCCGGAGTCCGGCTCGGGACACCCAGCATCATCTA

GCCATCTTCTACCTGGACTCTGAGGCTAGCATCCGGCTCACAGCTGAGCAAGCTCACTTCTTCCTG CACAGCGTCACCCTGGTACCTGTGGAGGAGTTC

AGTACTGAGTTTGTGGAGCCCCGGGTCTTCTGTGTGAGCAGTCATGGAACTTTCAACCCCAGCAG TGCTGCCTGTCTAGCCTCCCGATTCCCGAAGCCA

CCGCAGCCCATCATCCTTAAGGACTGCCAGGTCTTGCCGCTGCCTCCCGACCTGCCTCTGACTCAGTCTCAGGAGCTCTCACCAGGTGCACCCCCCGAGG

GACCACAGCCTCGGCCGCCAACTGCGGTGGATCCTAATGCAGAACCCACCTTGCTGCGCCACCCCCAG GGCACGGTGGTCTTCACCACCCAGGTGCCCA

CCCTGGGCCGCTATGCCTTTCTGCTGCACGGCTACCAGCCGGTCCACCCCTCCTTCCCTGTGGAGGTACTCATTAATGGTGGCCGCATCTGGCAGG GCC

ACGCCAACGCCAGCTTTTGTCCTCATGGTTATGGCTGCCGTACCCTGGTGTTGTGTGAGGGTCAGACGATGCTGGATGTTACAGACAACGAGCTCACCGT

GACTGTGCGTGTGCCAGAAGGCCGGTGGCTCTGGCTG GACTACGTACTCATTGTCCCTGAGGATGCTTACAGCTCCAGTTACCTCCAAGAGGAGCCTTT

GGACAAATCCTATGACTTCATCAGCCACTGTGCCACCCAGGGCTACCACATTAG CCCCAGCAGCTCATCTCCATTCTGCCGGAATGCCGCCACCTCCTT

GTCTCTCTTCTACAACAACGGGGCCCTCCCTTGTGGCTGCCACGAGGTGGGTGCCGTAAGCCCCACGTGCGAGCCCTTCGGGGGCCAGTGTCCCTGCCGG

GGCCACGTTATTGGCCGTGACTGTTCCCGCTGTGCCACCGGCTACTGGGGTTTCCCCAACTGCAGGC CCTGTGACTGTGGAGCCCGCCTGTGTGACGAG

CTCACGGGCCAGTGTATCTGTCCACCACGCACTGTTCCCCCTGACTGCTTGGTCTGCCAGCCACAGAGCTTTGGTTGCCACCCCTTGGTGGGCTGTGAGG

AGTGTAACTGCTCAGGGCCCGGCGTCCAGGAGCTGACGGACCCTACCTGTGACATGGACAGCGGCCAGTGCAG ATGCAGACCCAATGTAGCTGGACGTC

GCTGTGATACCTGTGCCCCGGGCTTCTATGGCTATCCTAGCTGTCGCCCCTGTGACTGCCATGAGGCAGGCACCATGGCTAGCGTGTGTGACCCCCTCAC

AGGCCAATGCCATTGCAAG GAGAACGTGCAGGGCTCAAGATGTGACCAGTGTCGCGTGGGGACCTTCTCCTTGGATGCTGCTAACCCCAAGGGCTGTAC

CCGCTGCTTCTGTTTCGGGGCCACAGAGCGCTGTGGGAACTCTAACCTCGCCCGCCATGAG TTCGTGGACATGGAGGGCTGGGTGCTGTTGAGCAGTGA

CCGGCAGGTGGTACCCCACGAGCATCGGCCTGAGATAGAGCTGCTGCACGCAGATCTGCGCTCTGTGGCTGACACTTTCTCAGAGCTGTACTGGCAGGCT

CCGCCCTCCTATCTGGGAGACAGG GTGTCATCCTACGGTGGAACCCTCCACTATGAGCTGCACTCAGAGACCCAGCGAGGTGATATCTTCATTCCCTAC

GAGAGCCGGCCGGACGTCGTGCTGCAG GGCAACCAAATGAGCATCGCCTTCCTGGAACTGGCGTACCCTCCGCCTGGCCAGGTTCACCGAGGACAGCTA

CAGCTGGTAGAG GGGAACTTCCGGCACTTGGAGACTCACAACCCCGTGTCCCGAGAAGAACTCATGATGGTGCTGGCCGGCCTGGAGCAGCTGCAGATC

CGTGCTCTCTTCTCGCAGACCTCTTCCAGTGTCTCCTTGCGTAGAGTGGTACTGGAGGTGGCTAGCGAGGCTGGTAGGGGGCCTCCAGCCAGCAATGTGG

AACTGTGTATGTGCCCTGCCAACTACCGTGGGGACTCGTGCCAG GAATGTGCCCCTGGCTATTACCGGGACACCAAGGGTCTCTTCCTAGGCCGATGTG

TCCCCTGTCAGTGCCATGGCCATTCAGATCGCTGCCTTCCTGGCTCTGGCATTTGTGTG GGCTGCCAGCACAACACAGAAGGGGACCAATGTGAGCGCT

GTAGGCCTGGCTTTGTCAGCAGTGATCCCAGTAACCCTGCATCCCCATGTGTGAGCTGCCCTTGCCCCTTGGCAGTGCCCTCCAATAA TTTTGCAGACG

GTTGCGTCTTAAGAAATGGCC GTTGTGACCGCTGTTTG GAAGGATACTTCGGTTTTGAGCAATGCCAGGGCTGCCGCCCTTGTGCCTGTGGACCAGCT

GCCAAGGGCTCCGAGTGCCACCCTCAGAGCGGTCAGTGTCACTGCCAGCCAGGGACCACAGGACCCCAGTGCCTCGAGTGCGCCCCTGGCTACTGGGGCC

TCCCAGAGAAGGGCTGCAGGC GCTGCCAGTGTCCCCGAGGCCACTGTGACCCACACACGGGCCACTGCACCTGTCCCCCGGGGCTCAGCGGGGAACGCT

GTGACACCTGCAGCCAGCAGCACCAGGTGCCTGTACCGGGCAAGCCTGGGGGCCATGGCATACACTGTGAAG - UNI10287 - TGTGTGACCACTGT

GTGGTTCTCCTTCTGGATGACCTCGAGCGGGCTGGTGCCCTCCTCCCCGCTATCCGTGAGCAGCTGCAGGGTATCAATGCCAGCTCCGCGGCCTGGGCCA

GGCTGCACAGGCTGAATGCCTCCATTGCTGACCTGCAG AGTAAACTCCGGAGCCCACCGGGACCCCGCTACCAGGCAGCACAGCAGCTACAGACTCTAG

AGCAGCAGAGTATAAGCCTTCAACAGGACACGGAGAGGCTGGGCAGTCAGGCAA AGCTGGCATCTCGCATGGGCCAAGGATCTCCAGGCGATGCCTTGG

TACCGTCTGGCGAGCAGCTGCGCTGGGCTCTGGCTGAAGTGGAGCGGCTGCTCTGGGATATGCGGACGCGTGACCTGGGGGCCCAGGGGGCAGTGGCAGA

GGCCGAACTGGCCGAAGCCCAGAGGC TGATGGCTCGTGTCCAGGAGCAGCTGACCAGCTTCTGGGAGGAGAACCAGTCATTGGCCACACACATTCGGGA

CCAGCTGGCTCAGTATGAGTCTGGCCTCATGGATCTTCGTGAGGCCCTGAACCAGGCCGTTAATACCACCCGGGAGGCTGAGGAACTCAACAGCCGCAAC

CAGGAACGGCTGAAGGAAGCCCTG - UNI9195 - CAATGGAAACAGGAACTGTCCCAGGACAATGCCACCCTGAAGGCCACTCTTCAAGCTGCCAGT

CTCATCTTGGGCCATGTTTCTGAGCTTCTGCAGGGCATAGACCAGGCTAAGGAG GACCTAGAGCACCTGGCGGCCAGCCTGGATGGAGCCTGGACACCC

TTACTGAAGAGGATGCAGGCCTTTTCCCCTGCCAGCAGCAAGGTGGACTTGGTAGAGGCTGCTGAGGCCCACGCTCAGAAGCTGAACCAGCTGGCAATCA

ACCTGTCTGG CATCATCCTTGGCATCAATCAGGACCGCTTCATCCAGAGGGCTGTGGAAGCCTCCAATGCCTACAGCAGCATCCTTCAGGCCGTTCAGG

CTGCCGAGGATGCGGCAGGCCAGGCACTGAGGCAGGCCAGCCGCACATGGGAG ATGGTGGTGCAGCGGGGCCTAGCAGCTGGAGCCCGGCAGCTGTTAG

CCAACAGCAGTGCCCTGGAGGAGACCATCCTTGGACACCAGGGGAGGCTGGGCCTTG CTCAGGGCCGTCTGCAGGCTGCGGGGATCCAGCTTCATAATG

TCTGGGCCAGGAAGAACCAGCTAGCAGCCCAGATCCAGGAGGCACAAGCCATGCTGGCCATGGACACGAGTAT TGGAGTTCACAATGCCAGCCTGGCTT

TGTCTGCCAACATTGGTCGTGTGCGCAAGCTCATTGCCCAAGCCCGGAGTGCCGCCAGCAAG GTCAAGGTGTCCATGAAGTTCAATGGGCGTTCAGGGG

TACGACTGCGTACCCCACGAGACCTTGCCGACCTTGCTGCGTACACTGCCCTCAAGTTCCACATCCAGAGCCCAGTGCCAGCGCCCGAACCTGGCAAGAA

CACGGGGGACCACTTTGTTCTGTACATGGGCAGCCGCCAG GCCACTGGGGACTACATGGGAGTGTCTCTGCGTAATCAGAAGGTGCACTGGGTGTACAG

GCTAGGAAAGGCTGGCCCCACAACTCTCAGCATCGACGAGAACATCGGGGAGCAGTTTGCAGCCGTCAGCATCGACAG GACCCTCCAGTTTGGCCACAT

GTCTGTCACCGTGGAGAAACAGATGGTTCATGAGATCAAGGGAGACACGGTGGCCCCTGGGAGCGAGGGACTACTCAACCTGCATCCTGACGATTTTGTC

TTCTACGTGGGAGGATACCCCAGCAACTTCACG CCCCCTGAACCCCTCCGATTCCCTGGCTACCTGGGCTGCATTGAGATGGAAACACTGAATGAGGAG

GTGGTCAGCCTCTACAATTTTGAGCAGACCTTCATGCTGGACACGGCAGTAGATAAACCTTGTGCTCG CTCCAAGGCCACCGGTGACCCATGGCTCACA

GATGGCTCCTACCTGGATGGCAGTGGCTTTGCCCGCATCAGCTTTGAGAAGCAGTTCAGCAACACAAAACGCTTTGACCAGGAGCTGCGGCTTGTGTCCT

ACAATGGGATCATCTTTTTCCTCAAGCAAGAG AGCCAGTTCTTGTGCCTGGCAGTGCAGGAAGGCACCCTGGTGCTCTTCTATGACTTCGGCTCTGGCC

TGAAGAAGGCCGACCCACTGCAGCCCCCACAAGCCTTGACGGCAGCCAGCAAGGCG ATCCAAGTGTTTCTATTGGCTGGCAATCGCAAACGTGTGTTGG

TGCGTGTGGAGCGGGCCACTGTGTTCAGCGTAGACCAGGATAACATGCTGGAGATGGCTGATGCCTACTACTTGGGAGGTGTGCCACCTGAACAGCTGCC

CTTGAG CCTACGGCAGCTCTTCCCCTCCGGAGGCTCTGTCCGTGGCTGCATCAAGGGTATTAAGGCTCTGGGCAAGTACGTGGACCTCAAACGGTTGAA

CACCACGGGCATCAGTTTCGGCTGCACCGCTGACCTGCTAGTGGGACGCACCATGACTTTTCACGGCCACGGCTTCCTGCCCCTGGCACTTCCTGATGTG

GCACCCATCACCGAAGTGGTCTATTCTGGCTTTGGCTTTCGTGGCACCCAGGACAACAACCTGCTGTATTACCGTACCTCCCCG GATGGGCCGTACCAG

GTATCCCTGAGGGAGGGCCACGTGACACTCCGTTTTATGAACCAAGAGGTGGAAACTCAAAGGGTCTTTGCTGATGGTGCTCCTCACTATGTTGCCTTCT

ATAGCAATGTCACAGG GGTATGGCTGTATGTGGATGACCAGCTACAACTAGTAAAGTCTCATGAGAGAACAACTCCCATGCTCCAACTACAGCCCGAGG

AACCCTCACGGCTTCTCCTGGGAGGCCTGCCTGTGTCTGGTACCTTCCACAACTTCAGTGGCTGCATCAGCAATGTTTTTGTACAGCG ACTTCGGGGAC

CACAGCGTGTGTTTGACCTACACCAGAACATGGGGAGTGTCAATGTAAGCGTAGGCTGTACACCAGCCCAACTCATCGAGACCTCAAGGGCCACGGCTCA

GAAG GTTTCCCGCCGTAGTCGACAACCCAGCCAGGACCTTGCCTGCACGACACCCTGGCTCCCTGGGACTATTCAGGATGCATACCAGTTTGGGGGACC

CCTGCCCAGTTACCTACAGTTTGTGGGTATCTCTCCGTCCCACAGGAATAG GCTCCACCTCTCCATGCTTGTCCGTCCACATGCGGCTTCCCAGGGCCT

CCTGCTCTCTACAGCCCCCATGTCGGGCCGCAGCCCTTCGTTGGTACTCTTTCTAAACCATGGACACTTTGTCGCACAGACTGAGGGCCCTGGGCCCCGG

CTCCAGGTCCAGAGTCGCCAGCACTCACGGGCTGGCCAGTGGCACAGG GTGTCCGTCCGCTGGGGAATGCAGCAGATCCAGCTTGTGGTGGACGGCAGC

CAGACCTGGAGCCAGAAGGCTCTCCACCATCGGGTCCCCAGGGCAGAGCGACCACAGCCCTACACCCTCTCTGTAGGAGGTCTTCCTGCCAGCAGTTACA

GTTCCAAGCTCCCT GTGTCTGTGGGGTTCAGCGGCTGTCTGAAGAAATTACAGCTGGATAAGCGGCCACTGAGGACCCCAACGCAAATGGTGGGGGTCA

CACCCTGTGTCTCAGGCCCCCTGGAAGATGGCCTGTTCTTCCCAGGCAGTGAGGGAGTTGTCACATTAG AGCTCCCCAAGGCCAAGATGCCCTATGTGA

GCCTGGAGCTAGAGATGCGGCCCTTGGCAGCTGCTGGCCTCATCTTCCACCTGGGCCAGGCCCTGGCCACTCCCTACATGCAGCTGAAGGTGCTGACAGA

ACAG GTCCTGCTGCAGGCAAATGATGGGGCAGGGGAGTTTTCCACGTGGGTGACCTACCCCAAGCTTTGTGATGGACGGTGGCACCGAGTGGCAG TGA

TCATGGGCAGGGACACACTCCGGCTGGAGGTAGACACACAGAGCAACCACACCACAGGCCGTTTGCCAGAGAGCTTGGCTGGTTCTCCAGCACTTCTGCA

CCTCGGGAGCCTGCCCA AGTCTTCAACTGCTCGGCCAGAGCTCCCTGCCTACCGAGGATGCTTGAGGAAGCTGCTGATCAATGGGGCCCCTGTCAACGT

GACTGCTTCTGTACAAATCCAGGGGGCAGTGGGGATGCGCGGATGCCCCTCAGGAACCCTAGCACTTTCCAAGCAGGGAAAGGCACTGACCCAGAGGCAG

GCCAAGCCCAGTGTCTCCCCGCTACTTTGGCATTGAGGGTTCCCAGACCTTGGGGTTTGCCTACACTTTCTATGAATAACAAGTCATTTCTGGTTTACAC

TGTCTTTTTAGAGGAAAAGGACTCTGTAGAACAGATATTATATTTATACTTTGTTCCTCCTGCCCAACAACTGTCAGTACTGAGATCTGAAATTAAAATG

ACTTGTTTGA
Translation
 - UNI11494 -  - UNI9493 - - UNI16308 -  - UNI16308 -    - UNI9131 -         - UNI10134 -  - UNI1013

4 -      - UNI28306 -  - UNI28306 -                   MSIAFLELAYPPPGQVHRGQLQLVE GNFRHLETHNPVSREELMMV

LAGLEQLQIRALFSQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQ ECAPGYYRDTKGLFLGRCVPCQCHGHSDRCLPGSGICV GCQ

HNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLAVPSNN NFADGCVLRNGR RCDRCL EGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGT

TGPQCLECAPGYWGLPEKGCRR RCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPGGHGIHCEV - UNI10287 - VCDHCVVLLLDD

LERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQ SKLRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQAK KLASRMGQGSPGDALVPSGE

QLRWALAEVERLLWDMRTRDLGAQGAVAEAELAEAQRL LMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREAEELNSRNQER

LKEAL - UNI9195 - QWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKE DLEHLAASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQK

LNQLAINLSG GIILGINQDRFIQRAVEASNAYSSILQAVQAAEDAAGQALRQASRTWE MVVQRGLAAGARQLLANSSALEETILGHQGRLGLA AQGR

LQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSI IGVHNASLALSANIGRVRKLIAQARSAASK VKVSMKFNGRSGVRLRTPRDLADLAAYTALKFH

IQSPVPAPEPGKNTGDHFVLYMGSRQ ATGDYMGVSLRNQKVHWVYRLGKAGPTTLSIDENIGEQFAAVSIDR RTLQFGHMSVTVEKQMVHEIKGDTVA

PGSEGLLNLHPDDFVFYVGGYPSNFT PPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCAR RSKATGDPWLTDGSYLDGSGFARISFE

KQFSNTKRFDQELRLVSYNGIIFFLKQE SQFLCLAVQEGTLVLFYDFGSGLKKADPLQPPQALTAASKA IQVFLLAGNRKRVLVRVERATVFSVDQDN

MLEMADAYYLGGVPPEQLPLS SLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCTADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGF

RGTQDNNLLYYRTSP DGPYQVSLREGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTG GVWLYVDDQLQLVKSHERTTPMLQLQPEEPSRLLLGGLP

VSGTFHNFSGCISNVFVQR RLRGPQRVFDLHQNMGSVNVSVGCTPAQLIETSRATAQK VSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFV

GISPSHRNR RLHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRAGQWHR VSVRWGMQQIQLVVDGSQTWSQK

ALHHRVPRAERPQPYTLSVGGLPASSYSSKLP VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLE ELPKAKMPYVSLEL

EMRPLAAAGLIFHLGQALATPYMQLKVLTEQ VLLQANDGAGEFSTWVTYPKLCDGRWHRVAV VIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHL

GSLPK KSSTARPELPAYRGCLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH

For any suggestions or comments, please send an email to unitrap@crg.es